Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2MC11

Protein Details
Accession A0A0D2MC11    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
124-147RSDSEVSQPKKPSKRARLKAWFKGHydrophilic
NLS Segment(s)
PositionSequence
133-147KKPSKRARLKAWFKG
Subcellular Location(s) nucl 13.5, cyto_nucl 11.5, cyto 8.5, mito 2, golg 2
Family & Domain DBs
Amino Acid Sequences MDFGDGGKFYDEMFNTIVRYVKAEFPDMLHFLTLEHDISKVLEEIELEQAQLRPTDKDMEPSADRLEELKISSLSVEHNTEENPEAALTTPLAPETMNTVQPSSSNAHFDNSMKLRMESALQVRSDSEVSQPKKPSKRARLKAWFKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.18
4 0.19
5 0.15
6 0.17
7 0.17
8 0.2
9 0.21
10 0.23
11 0.22
12 0.22
13 0.26
14 0.25
15 0.23
16 0.18
17 0.16
18 0.13
19 0.14
20 0.13
21 0.1
22 0.09
23 0.08
24 0.08
25 0.09
26 0.09
27 0.08
28 0.07
29 0.07
30 0.06
31 0.08
32 0.11
33 0.11
34 0.1
35 0.11
36 0.11
37 0.12
38 0.13
39 0.12
40 0.09
41 0.11
42 0.16
43 0.15
44 0.18
45 0.19
46 0.22
47 0.22
48 0.22
49 0.22
50 0.17
51 0.17
52 0.14
53 0.13
54 0.09
55 0.09
56 0.09
57 0.08
58 0.08
59 0.07
60 0.07
61 0.07
62 0.08
63 0.09
64 0.08
65 0.09
66 0.09
67 0.1
68 0.11
69 0.1
70 0.08
71 0.07
72 0.07
73 0.07
74 0.07
75 0.06
76 0.06
77 0.06
78 0.05
79 0.06
80 0.05
81 0.05
82 0.1
83 0.12
84 0.14
85 0.14
86 0.15
87 0.14
88 0.15
89 0.17
90 0.15
91 0.15
92 0.16
93 0.16
94 0.18
95 0.19
96 0.2
97 0.25
98 0.24
99 0.27
100 0.24
101 0.24
102 0.23
103 0.22
104 0.23
105 0.2
106 0.23
107 0.23
108 0.22
109 0.22
110 0.22
111 0.24
112 0.23
113 0.19
114 0.21
115 0.25
116 0.29
117 0.35
118 0.42
119 0.49
120 0.57
121 0.66
122 0.71
123 0.73
124 0.81
125 0.83
126 0.87
127 0.89