Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2PIC7

Protein Details
Accession A0A0D2PIC7    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
39-60AERMVNKRQISKSNRRKAPFYKHydrophilic
456-477VDKWEIERKKRVKDSIIPYRNIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11.5, cyto_nucl 10.5, nucl 8.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR011084  DRMBL  
IPR036866  RibonucZ/Hydroxyglut_hydro  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF07522  DRMBL  
CDD cd16273  SNM1A-1C-like_MBL-fold  
Amino Acid Sequences MRKRELVSCDGKRGAVDNAFSVLMTTLKENEIWKEADIAERMVNKRQISKSNRRKAPFYKVLQGMPVAVDAFKYGAIPGVTAYFLTHAHSDHYTNLSSSWKHGPIYCSEGTANLIIHMLSVEKKWVHPLPMDTPTIIPNTNGVTVTLIEANHCPGSCLFFYEGRQTVNAGDSTYKSASVGSQKVFRYLHCGDFRASPRHVLHPAVKDKVIDHVYLDTTYLDPKYTFPPQPLVISACAELAKRLHDGQSTDEKNSTMLSWVSSFDSKGKGKERARPLFVVGTYSIGKERIVKAIAHALNSKVYCDGRKAAILKCQGDSELDALLTDNPRDALVHLVPLGTITFEDLKKYLDRYKGFYTNIVGFRPTGWTYVPTAGKSTLPPISSVIAQGSARRNFKHTDLKVSGKSTSALQLYPIPYSEHSSFYELTCFAMSFSWSKMIATVNVGSDSSRCKMKHWVDKWEIERKKRVKDSIIPYRNIDYW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.34
3 0.3
4 0.24
5 0.24
6 0.23
7 0.22
8 0.2
9 0.15
10 0.12
11 0.11
12 0.11
13 0.11
14 0.12
15 0.15
16 0.16
17 0.19
18 0.22
19 0.23
20 0.21
21 0.23
22 0.22
23 0.25
24 0.24
25 0.23
26 0.22
27 0.28
28 0.3
29 0.34
30 0.39
31 0.37
32 0.44
33 0.48
34 0.54
35 0.58
36 0.67
37 0.71
38 0.76
39 0.82
40 0.78
41 0.81
42 0.79
43 0.8
44 0.78
45 0.74
46 0.72
47 0.68
48 0.65
49 0.58
50 0.51
51 0.4
52 0.31
53 0.25
54 0.17
55 0.12
56 0.1
57 0.08
58 0.08
59 0.07
60 0.07
61 0.06
62 0.08
63 0.08
64 0.09
65 0.09
66 0.09
67 0.09
68 0.09
69 0.09
70 0.08
71 0.08
72 0.1
73 0.11
74 0.1
75 0.13
76 0.15
77 0.16
78 0.17
79 0.2
80 0.18
81 0.18
82 0.19
83 0.2
84 0.19
85 0.21
86 0.25
87 0.25
88 0.26
89 0.28
90 0.3
91 0.29
92 0.35
93 0.31
94 0.27
95 0.24
96 0.24
97 0.22
98 0.21
99 0.17
100 0.11
101 0.11
102 0.08
103 0.08
104 0.07
105 0.07
106 0.07
107 0.07
108 0.1
109 0.11
110 0.12
111 0.18
112 0.21
113 0.23
114 0.24
115 0.28
116 0.3
117 0.34
118 0.35
119 0.29
120 0.27
121 0.26
122 0.25
123 0.21
124 0.16
125 0.13
126 0.13
127 0.14
128 0.13
129 0.12
130 0.1
131 0.1
132 0.11
133 0.11
134 0.09
135 0.09
136 0.1
137 0.11
138 0.12
139 0.11
140 0.11
141 0.1
142 0.13
143 0.12
144 0.14
145 0.14
146 0.15
147 0.17
148 0.21
149 0.23
150 0.2
151 0.2
152 0.18
153 0.17
154 0.17
155 0.16
156 0.11
157 0.11
158 0.11
159 0.14
160 0.14
161 0.13
162 0.11
163 0.11
164 0.12
165 0.17
166 0.19
167 0.17
168 0.23
169 0.23
170 0.28
171 0.28
172 0.26
173 0.28
174 0.27
175 0.33
176 0.29
177 0.31
178 0.27
179 0.33
180 0.37
181 0.35
182 0.33
183 0.31
184 0.31
185 0.34
186 0.34
187 0.31
188 0.32
189 0.35
190 0.39
191 0.35
192 0.34
193 0.3
194 0.28
195 0.31
196 0.27
197 0.2
198 0.16
199 0.15
200 0.15
201 0.14
202 0.14
203 0.09
204 0.08
205 0.09
206 0.08
207 0.08
208 0.07
209 0.09
210 0.12
211 0.17
212 0.18
213 0.18
214 0.21
215 0.21
216 0.22
217 0.22
218 0.19
219 0.15
220 0.15
221 0.14
222 0.11
223 0.1
224 0.09
225 0.09
226 0.08
227 0.08
228 0.09
229 0.09
230 0.1
231 0.11
232 0.12
233 0.15
234 0.23
235 0.24
236 0.23
237 0.24
238 0.22
239 0.21
240 0.2
241 0.17
242 0.09
243 0.08
244 0.08
245 0.08
246 0.08
247 0.1
248 0.1
249 0.1
250 0.1
251 0.15
252 0.16
253 0.2
254 0.24
255 0.31
256 0.35
257 0.43
258 0.51
259 0.53
260 0.55
261 0.51
262 0.49
263 0.43
264 0.39
265 0.33
266 0.23
267 0.18
268 0.15
269 0.15
270 0.13
271 0.11
272 0.11
273 0.12
274 0.13
275 0.14
276 0.15
277 0.15
278 0.15
279 0.23
280 0.24
281 0.22
282 0.22
283 0.2
284 0.22
285 0.22
286 0.21
287 0.15
288 0.16
289 0.15
290 0.16
291 0.18
292 0.16
293 0.2
294 0.22
295 0.22
296 0.27
297 0.31
298 0.3
299 0.29
300 0.28
301 0.25
302 0.22
303 0.21
304 0.15
305 0.11
306 0.09
307 0.08
308 0.08
309 0.09
310 0.09
311 0.08
312 0.07
313 0.07
314 0.07
315 0.08
316 0.08
317 0.1
318 0.1
319 0.11
320 0.11
321 0.1
322 0.1
323 0.1
324 0.09
325 0.05
326 0.05
327 0.05
328 0.09
329 0.09
330 0.11
331 0.11
332 0.13
333 0.15
334 0.18
335 0.23
336 0.27
337 0.3
338 0.34
339 0.4
340 0.44
341 0.44
342 0.42
343 0.4
344 0.39
345 0.39
346 0.35
347 0.29
348 0.23
349 0.22
350 0.24
351 0.21
352 0.16
353 0.14
354 0.15
355 0.17
356 0.24
357 0.25
358 0.22
359 0.23
360 0.23
361 0.23
362 0.22
363 0.24
364 0.21
365 0.2
366 0.2
367 0.19
368 0.2
369 0.19
370 0.19
371 0.15
372 0.14
373 0.14
374 0.18
375 0.24
376 0.29
377 0.33
378 0.33
379 0.36
380 0.36
381 0.43
382 0.49
383 0.44
384 0.47
385 0.49
386 0.54
387 0.56
388 0.55
389 0.5
390 0.4
391 0.39
392 0.3
393 0.3
394 0.25
395 0.2
396 0.19
397 0.23
398 0.23
399 0.23
400 0.23
401 0.2
402 0.19
403 0.25
404 0.25
405 0.23
406 0.24
407 0.27
408 0.27
409 0.25
410 0.27
411 0.21
412 0.2
413 0.18
414 0.16
415 0.12
416 0.12
417 0.13
418 0.12
419 0.14
420 0.16
421 0.16
422 0.16
423 0.17
424 0.18
425 0.18
426 0.2
427 0.2
428 0.18
429 0.19
430 0.19
431 0.17
432 0.17
433 0.2
434 0.19
435 0.24
436 0.23
437 0.25
438 0.35
439 0.45
440 0.54
441 0.56
442 0.64
443 0.65
444 0.73
445 0.78
446 0.78
447 0.77
448 0.74
449 0.78
450 0.75
451 0.78
452 0.78
453 0.79
454 0.77
455 0.78
456 0.8
457 0.81
458 0.82
459 0.75
460 0.7