Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6BPG4

Protein Details
Accession Q6BPG4    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
145-167LTWFYLKKKTFNKRRKGLLPYKNHydrophilic
304-324SISEKRCKKPLPKLPPIINTYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 8, pero 4, mito 3, cyto 2.5, extr 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036028  SH3-like_dom_sf  
IPR001452  SH3_domain  
Gene Ontology GO:0016020  C:membrane  
KEGG dha:DEHA2E13816g  -  
Pfam View protein in Pfam  
PF00018  SH3_1  
PROSITE View protein in PROSITE  
PS50002  SH3  
Amino Acid Sequences MSITVIAKRETTDEDLTILMTLTSTLTVSSLPASLIPTISNKAKKSYTSTTLRTSSVKSSSPSKQTSTTSNRPKTLLSIPSALVSKFSLQSETMSNSARSTHTSEPFHSNLDSVAGLSQENRSLKLGLAIGIPIAIVSILVGIILTWFYLKKKTFNKRRKGLLPYKNEYLEHSNDEKLTMNETKFQASSMNSVSTKFQGLNETPVQMQQGPNQQLTQTSVKNFFNRLSRTVNIRNVNETDVDTLNENKSGLVSPIFLKKFNLRKSVCKPNDVYNSEERLRRTNGLLRSIDADFLSIPYNDSKISISEKRCKKPLPKLPPIINTYKSKSLHDMEKVVTHTSLSSASIINRDDKMYKVIKPYVKNLDDEISIKVGDRVRILTEHSDGWCSARLIEENEYSNYTSPKQGVIPRLCLQKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.24
4 0.21
5 0.16
6 0.1
7 0.07
8 0.07
9 0.06
10 0.06
11 0.06
12 0.06
13 0.06
14 0.06
15 0.07
16 0.08
17 0.08
18 0.08
19 0.09
20 0.1
21 0.11
22 0.11
23 0.12
24 0.14
25 0.18
26 0.25
27 0.31
28 0.31
29 0.36
30 0.4
31 0.42
32 0.47
33 0.5
34 0.51
35 0.53
36 0.56
37 0.57
38 0.56
39 0.55
40 0.5
41 0.46
42 0.43
43 0.39
44 0.38
45 0.34
46 0.38
47 0.42
48 0.48
49 0.49
50 0.47
51 0.47
52 0.47
53 0.53
54 0.55
55 0.58
56 0.61
57 0.64
58 0.64
59 0.6
60 0.58
61 0.53
62 0.51
63 0.47
64 0.39
65 0.35
66 0.32
67 0.33
68 0.33
69 0.28
70 0.22
71 0.18
72 0.17
73 0.16
74 0.16
75 0.16
76 0.15
77 0.17
78 0.18
79 0.2
80 0.2
81 0.19
82 0.19
83 0.18
84 0.19
85 0.19
86 0.19
87 0.22
88 0.26
89 0.3
90 0.33
91 0.35
92 0.39
93 0.4
94 0.38
95 0.33
96 0.27
97 0.21
98 0.19
99 0.16
100 0.1
101 0.09
102 0.07
103 0.07
104 0.08
105 0.09
106 0.12
107 0.13
108 0.14
109 0.15
110 0.15
111 0.15
112 0.17
113 0.16
114 0.12
115 0.12
116 0.11
117 0.09
118 0.08
119 0.08
120 0.05
121 0.04
122 0.03
123 0.02
124 0.02
125 0.02
126 0.02
127 0.02
128 0.02
129 0.02
130 0.02
131 0.02
132 0.02
133 0.03
134 0.04
135 0.05
136 0.12
137 0.13
138 0.21
139 0.31
140 0.42
141 0.52
142 0.62
143 0.71
144 0.73
145 0.81
146 0.81
147 0.81
148 0.81
149 0.79
150 0.78
151 0.73
152 0.69
153 0.63
154 0.55
155 0.48
156 0.42
157 0.35
158 0.31
159 0.27
160 0.24
161 0.22
162 0.23
163 0.21
164 0.17
165 0.18
166 0.17
167 0.16
168 0.19
169 0.2
170 0.2
171 0.19
172 0.19
173 0.17
174 0.15
175 0.17
176 0.13
177 0.16
178 0.14
179 0.15
180 0.16
181 0.14
182 0.15
183 0.12
184 0.12
185 0.13
186 0.13
187 0.17
188 0.17
189 0.17
190 0.16
191 0.16
192 0.16
193 0.14
194 0.14
195 0.13
196 0.19
197 0.2
198 0.21
199 0.2
200 0.2
201 0.19
202 0.22
203 0.22
204 0.17
205 0.17
206 0.21
207 0.22
208 0.24
209 0.25
210 0.24
211 0.27
212 0.27
213 0.29
214 0.29
215 0.29
216 0.34
217 0.38
218 0.42
219 0.41
220 0.4
221 0.39
222 0.36
223 0.35
224 0.29
225 0.24
226 0.19
227 0.14
228 0.14
229 0.12
230 0.12
231 0.12
232 0.11
233 0.11
234 0.08
235 0.08
236 0.08
237 0.08
238 0.07
239 0.08
240 0.09
241 0.16
242 0.17
243 0.17
244 0.19
245 0.25
246 0.33
247 0.38
248 0.45
249 0.41
250 0.49
251 0.56
252 0.66
253 0.61
254 0.59
255 0.56
256 0.55
257 0.62
258 0.55
259 0.52
260 0.47
261 0.49
262 0.47
263 0.48
264 0.4
265 0.36
266 0.37
267 0.34
268 0.32
269 0.33
270 0.34
271 0.38
272 0.37
273 0.33
274 0.33
275 0.31
276 0.28
277 0.21
278 0.17
279 0.11
280 0.11
281 0.11
282 0.08
283 0.09
284 0.09
285 0.1
286 0.1
287 0.11
288 0.1
289 0.11
290 0.17
291 0.23
292 0.29
293 0.38
294 0.47
295 0.52
296 0.59
297 0.64
298 0.67
299 0.71
300 0.75
301 0.76
302 0.77
303 0.8
304 0.81
305 0.8
306 0.77
307 0.72
308 0.67
309 0.62
310 0.57
311 0.56
312 0.5
313 0.46
314 0.46
315 0.44
316 0.46
317 0.44
318 0.43
319 0.36
320 0.39
321 0.38
322 0.34
323 0.29
324 0.23
325 0.19
326 0.16
327 0.15
328 0.12
329 0.11
330 0.11
331 0.12
332 0.16
333 0.17
334 0.19
335 0.2
336 0.21
337 0.22
338 0.22
339 0.27
340 0.28
341 0.3
342 0.34
343 0.41
344 0.45
345 0.48
346 0.54
347 0.58
348 0.56
349 0.54
350 0.5
351 0.45
352 0.41
353 0.37
354 0.32
355 0.23
356 0.2
357 0.19
358 0.21
359 0.2
360 0.2
361 0.21
362 0.2
363 0.21
364 0.23
365 0.26
366 0.25
367 0.25
368 0.26
369 0.25
370 0.26
371 0.24
372 0.25
373 0.25
374 0.21
375 0.19
376 0.2
377 0.21
378 0.22
379 0.26
380 0.28
381 0.27
382 0.29
383 0.31
384 0.29
385 0.29
386 0.28
387 0.26
388 0.27
389 0.25
390 0.25
391 0.29
392 0.34
393 0.42
394 0.44
395 0.5
396 0.51