Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2P0S3

Protein Details
Accession A0A0D2P0S3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
158-186DKEAPASKRQEKLRKRQEKGDPRVRAQSGBasic
NLS Segment(s)
PositionSequence
163-188ASKRQEKLRKRQEKGDPRVRAQSGRK
Subcellular Location(s) plas 19, mito 5, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008506  SND2/TMEM208  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
Pfam View protein in Pfam  
PF05620  TMEM208_SND2  
Amino Acid Sequences MANASGKRIANQNESSVKTLRIGMILPTIISLVLRFLFRRSSLPPSKGSLAIYVVTFFPAFFLSNYLVKIGTPRRDPTTGTLISYGEDLGQSGVTEWCFDILYITWACQIGSGVFGEWFWWLYMVIPLYAILKLWISVISPMFFRRGSSESPETTAADKEAPASKRQEKLRKRQEKGDPRVRAQSGRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.48
3 0.43
4 0.38
5 0.33
6 0.32
7 0.26
8 0.2
9 0.18
10 0.16
11 0.16
12 0.15
13 0.13
14 0.12
15 0.11
16 0.09
17 0.09
18 0.07
19 0.06
20 0.07
21 0.08
22 0.09
23 0.1
24 0.14
25 0.15
26 0.19
27 0.21
28 0.3
29 0.36
30 0.39
31 0.4
32 0.41
33 0.43
34 0.41
35 0.37
36 0.29
37 0.23
38 0.21
39 0.18
40 0.14
41 0.12
42 0.11
43 0.1
44 0.08
45 0.07
46 0.07
47 0.07
48 0.07
49 0.09
50 0.1
51 0.11
52 0.12
53 0.12
54 0.11
55 0.1
56 0.15
57 0.18
58 0.21
59 0.23
60 0.26
61 0.3
62 0.31
63 0.33
64 0.32
65 0.33
66 0.29
67 0.26
68 0.24
69 0.2
70 0.18
71 0.17
72 0.13
73 0.06
74 0.06
75 0.05
76 0.04
77 0.04
78 0.03
79 0.04
80 0.04
81 0.04
82 0.05
83 0.04
84 0.05
85 0.05
86 0.05
87 0.05
88 0.04
89 0.07
90 0.07
91 0.07
92 0.07
93 0.07
94 0.08
95 0.07
96 0.07
97 0.05
98 0.06
99 0.06
100 0.05
101 0.05
102 0.05
103 0.05
104 0.05
105 0.06
106 0.05
107 0.05
108 0.05
109 0.05
110 0.07
111 0.07
112 0.07
113 0.06
114 0.07
115 0.07
116 0.07
117 0.07
118 0.05
119 0.05
120 0.05
121 0.06
122 0.06
123 0.05
124 0.07
125 0.09
126 0.09
127 0.1
128 0.11
129 0.13
130 0.13
131 0.13
132 0.15
133 0.17
134 0.2
135 0.26
136 0.3
137 0.29
138 0.31
139 0.32
140 0.3
141 0.28
142 0.26
143 0.2
144 0.16
145 0.15
146 0.15
147 0.2
148 0.21
149 0.24
150 0.31
151 0.36
152 0.43
153 0.53
154 0.6
155 0.63
156 0.73
157 0.8
158 0.83
159 0.83
160 0.85
161 0.86
162 0.87
163 0.88
164 0.87
165 0.84
166 0.79
167 0.82
168 0.76