Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2PRK7

Protein Details
Accession A0A0D2PRK7   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
299-321RCVQGGKPIRARKKGKSRADVTEHydrophilic
331-353AEESAPPRPKPRPRKAVAPAAKSHydrophilic
NLS Segment(s)
PositionSequence
308-318KPIRARKKGKS
339-370PPRPKPRPRKAVAPAAKSGTGRKLLXIKRRQK
Subcellular Location(s) cyto 14, cyto_nucl 11, nucl 6, mito 4
Family & Domain DBs
Amino Acid Sequences MSAAQRKISSNEAAALIPVVDGMLRRAVREGNLEEVTERERGNLTAILGHPDHNLLRQSHPAYLWGYSSRYKAARKAKTLTPEFYALENARVDAFLAKTGRKERAGTAGVDAPVPSRTDEISAGLVRMSLDPEDPLRDAXGTRAKGSGVRFSPLPPPRGNEQSGSGRRNERPVPTFQAIDEESEDVDMDDGKGEGSSGKRKRPTEEEWVSPAEDEPPQAPAPPPVDNKRRRTAEPTGGSXQRXTPLPTDIAIVPPCERCARSSLHCVQQKGGDDDNEGTSSKKRRGGSTLKACYHCATTRHRCVQGGKPIRARKKGKSRADVTEMEENEEDELAEESAPPRPKPRPRKAVAPAAKSGTGRKLLXIKRRQKC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.2
3 0.15
4 0.12
5 0.09
6 0.06
7 0.05
8 0.05
9 0.07
10 0.13
11 0.13
12 0.14
13 0.17
14 0.19
15 0.21
16 0.27
17 0.27
18 0.27
19 0.28
20 0.28
21 0.26
22 0.26
23 0.26
24 0.22
25 0.2
26 0.15
27 0.16
28 0.16
29 0.18
30 0.18
31 0.16
32 0.18
33 0.18
34 0.21
35 0.2
36 0.21
37 0.19
38 0.19
39 0.2
40 0.19
41 0.23
42 0.21
43 0.23
44 0.3
45 0.31
46 0.32
47 0.31
48 0.3
49 0.28
50 0.26
51 0.26
52 0.21
53 0.22
54 0.22
55 0.24
56 0.26
57 0.3
58 0.32
59 0.39
60 0.46
61 0.51
62 0.55
63 0.59
64 0.59
65 0.64
66 0.65
67 0.6
68 0.53
69 0.48
70 0.42
71 0.38
72 0.37
73 0.27
74 0.25
75 0.22
76 0.19
77 0.16
78 0.14
79 0.14
80 0.11
81 0.11
82 0.11
83 0.13
84 0.14
85 0.19
86 0.23
87 0.28
88 0.28
89 0.3
90 0.28
91 0.34
92 0.35
93 0.31
94 0.29
95 0.28
96 0.25
97 0.23
98 0.21
99 0.14
100 0.13
101 0.13
102 0.11
103 0.09
104 0.09
105 0.1
106 0.11
107 0.11
108 0.13
109 0.12
110 0.12
111 0.1
112 0.1
113 0.09
114 0.09
115 0.08
116 0.06
117 0.06
118 0.07
119 0.08
120 0.1
121 0.1
122 0.1
123 0.1
124 0.1
125 0.11
126 0.14
127 0.19
128 0.17
129 0.17
130 0.19
131 0.21
132 0.22
133 0.27
134 0.24
135 0.2
136 0.2
137 0.22
138 0.28
139 0.3
140 0.33
141 0.27
142 0.3
143 0.32
144 0.37
145 0.37
146 0.29
147 0.29
148 0.34
149 0.39
150 0.37
151 0.36
152 0.36
153 0.36
154 0.4
155 0.39
156 0.35
157 0.32
158 0.34
159 0.38
160 0.34
161 0.33
162 0.28
163 0.28
164 0.23
165 0.21
166 0.18
167 0.11
168 0.1
169 0.09
170 0.09
171 0.05
172 0.05
173 0.04
174 0.03
175 0.03
176 0.03
177 0.03
178 0.03
179 0.03
180 0.05
181 0.07
182 0.16
183 0.2
184 0.26
185 0.32
186 0.34
187 0.39
188 0.44
189 0.47
190 0.49
191 0.49
192 0.46
193 0.43
194 0.42
195 0.38
196 0.32
197 0.26
198 0.18
199 0.14
200 0.11
201 0.09
202 0.1
203 0.1
204 0.11
205 0.11
206 0.13
207 0.15
208 0.19
209 0.23
210 0.28
211 0.38
212 0.46
213 0.52
214 0.57
215 0.59
216 0.58
217 0.6
218 0.6
219 0.6
220 0.56
221 0.55
222 0.55
223 0.52
224 0.49
225 0.43
226 0.39
227 0.32
228 0.29
229 0.24
230 0.18
231 0.16
232 0.18
233 0.18
234 0.18
235 0.16
236 0.15
237 0.16
238 0.15
239 0.17
240 0.17
241 0.17
242 0.15
243 0.18
244 0.21
245 0.24
246 0.32
247 0.36
248 0.43
249 0.46
250 0.46
251 0.44
252 0.44
253 0.44
254 0.4
255 0.36
256 0.28
257 0.26
258 0.26
259 0.26
260 0.22
261 0.19
262 0.16
263 0.19
264 0.23
265 0.27
266 0.32
267 0.33
268 0.35
269 0.44
270 0.51
271 0.56
272 0.62
273 0.65
274 0.66
275 0.66
276 0.63
277 0.56
278 0.53
279 0.46
280 0.41
281 0.42
282 0.45
283 0.53
284 0.58
285 0.6
286 0.59
287 0.61
288 0.64
289 0.65
290 0.65
291 0.63
292 0.64
293 0.7
294 0.75
295 0.8
296 0.78
297 0.78
298 0.79
299 0.82
300 0.83
301 0.84
302 0.81
303 0.79
304 0.79
305 0.72
306 0.65
307 0.63
308 0.53
309 0.47
310 0.41
311 0.33
312 0.27
313 0.23
314 0.18
315 0.1
316 0.11
317 0.08
318 0.08
319 0.08
320 0.08
321 0.15
322 0.2
323 0.21
324 0.27
325 0.36
326 0.47
327 0.57
328 0.67
329 0.72
330 0.73
331 0.82
332 0.84
333 0.85
334 0.84
335 0.79
336 0.73
337 0.67
338 0.65
339 0.56
340 0.52
341 0.48
342 0.44
343 0.4
344 0.42
345 0.47
346 0.54
347 0.62