Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9E158

Protein Details
Accession E9E158   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
155-181SSLQAKASRKHPKEYRKARERYPSPDYHydrophilic
NLS Segment(s)
PositionSequence
161-173ASRKHPKEYRKAR
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019371  KxDL_dom  
Gene Ontology GO:0005768  C:endosome  
KEGG maw:MAC_03606  -  
Pfam View protein in Pfam  
PF10241  KxDL  
Amino Acid Sequences MSGPFPTVSYSMPMAVPGKGNQYPTYTHYSMSPPECDDDMSSASGVPSYSNSGCTGSASYMGSNDYDSANSASGIDFQEYMQDRFANSFNPIPLDRSMAVQAQTSGKLNAKHRELMDLQKQAQARLAKTRERFQDGMRDAREVRGDLEWTQKKVSSLQAKASRKHPKEYRKARERYPSPDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.18
4 0.17
5 0.22
6 0.23
7 0.26
8 0.26
9 0.27
10 0.28
11 0.3
12 0.37
13 0.3
14 0.28
15 0.28
16 0.3
17 0.33
18 0.33
19 0.31
20 0.24
21 0.26
22 0.26
23 0.25
24 0.22
25 0.19
26 0.17
27 0.15
28 0.14
29 0.11
30 0.11
31 0.1
32 0.09
33 0.07
34 0.07
35 0.1
36 0.1
37 0.12
38 0.13
39 0.13
40 0.13
41 0.14
42 0.14
43 0.1
44 0.12
45 0.11
46 0.1
47 0.09
48 0.09
49 0.09
50 0.08
51 0.08
52 0.07
53 0.07
54 0.08
55 0.08
56 0.08
57 0.07
58 0.07
59 0.06
60 0.08
61 0.08
62 0.07
63 0.07
64 0.06
65 0.11
66 0.13
67 0.13
68 0.13
69 0.12
70 0.12
71 0.13
72 0.14
73 0.1
74 0.11
75 0.11
76 0.1
77 0.12
78 0.13
79 0.13
80 0.13
81 0.14
82 0.13
83 0.13
84 0.14
85 0.13
86 0.13
87 0.11
88 0.12
89 0.11
90 0.11
91 0.11
92 0.11
93 0.13
94 0.17
95 0.22
96 0.27
97 0.29
98 0.32
99 0.31
100 0.34
101 0.33
102 0.35
103 0.38
104 0.36
105 0.34
106 0.34
107 0.35
108 0.3
109 0.34
110 0.3
111 0.25
112 0.29
113 0.32
114 0.36
115 0.39
116 0.46
117 0.46
118 0.5
119 0.49
120 0.43
121 0.49
122 0.45
123 0.49
124 0.43
125 0.41
126 0.35
127 0.36
128 0.36
129 0.26
130 0.24
131 0.19
132 0.2
133 0.18
134 0.28
135 0.3
136 0.3
137 0.31
138 0.31
139 0.31
140 0.31
141 0.39
142 0.38
143 0.37
144 0.44
145 0.52
146 0.57
147 0.6
148 0.67
149 0.69
150 0.64
151 0.71
152 0.71
153 0.72
154 0.77
155 0.83
156 0.85
157 0.84
158 0.88
159 0.86
160 0.88
161 0.84