Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2N701

Protein Details
Accession A0A0D2N701    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
163-203APVLNFTSPRARRRRRSCFSSPALRRCRLRYPPRTRSPGTHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MPPCSPTTATMSAGRPENCASVDMTXSRTLSRASRRMPTAPLQTRKTLVRRRCFLLQVRRLFSRIFLADLRSLTRRDAVPRNRPAISTFTSLPRLPVREVHPASPLPLRCFLHTRDFCTEERRGSPACLVQLPPYAAPGSLGCICPSNIRQPHPPNAAPPRLAAPVLNFTSPRARRRRRSCFSSPALRRCRLRYPPRTRSPGTHSADLHSQPSPVPLFPVPSISAHQQASSDSSRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.33
3 0.32
4 0.31
5 0.27
6 0.25
7 0.22
8 0.18
9 0.21
10 0.2
11 0.21
12 0.2
13 0.2
14 0.2
15 0.22
16 0.23
17 0.27
18 0.33
19 0.36
20 0.42
21 0.46
22 0.48
23 0.49
24 0.52
25 0.55
26 0.57
27 0.6
28 0.57
29 0.56
30 0.56
31 0.59
32 0.61
33 0.6
34 0.6
35 0.61
36 0.62
37 0.64
38 0.66
39 0.66
40 0.65
41 0.67
42 0.66
43 0.64
44 0.64
45 0.6
46 0.56
47 0.5
48 0.42
49 0.37
50 0.28
51 0.23
52 0.2
53 0.2
54 0.21
55 0.21
56 0.23
57 0.19
58 0.19
59 0.18
60 0.2
61 0.19
62 0.23
63 0.32
64 0.38
65 0.45
66 0.51
67 0.55
68 0.52
69 0.51
70 0.47
71 0.43
72 0.37
73 0.31
74 0.25
75 0.24
76 0.26
77 0.26
78 0.26
79 0.24
80 0.23
81 0.2
82 0.23
83 0.24
84 0.31
85 0.32
86 0.31
87 0.31
88 0.29
89 0.3
90 0.3
91 0.27
92 0.2
93 0.24
94 0.24
95 0.22
96 0.25
97 0.26
98 0.32
99 0.32
100 0.34
101 0.32
102 0.34
103 0.33
104 0.35
105 0.35
106 0.26
107 0.26
108 0.25
109 0.22
110 0.19
111 0.2
112 0.17
113 0.16
114 0.15
115 0.14
116 0.13
117 0.15
118 0.15
119 0.13
120 0.13
121 0.11
122 0.1
123 0.1
124 0.08
125 0.09
126 0.1
127 0.1
128 0.09
129 0.1
130 0.11
131 0.13
132 0.15
133 0.21
134 0.24
135 0.27
136 0.35
137 0.39
138 0.47
139 0.51
140 0.5
141 0.49
142 0.52
143 0.52
144 0.44
145 0.4
146 0.35
147 0.3
148 0.3
149 0.22
150 0.17
151 0.19
152 0.2
153 0.2
154 0.17
155 0.17
156 0.27
157 0.31
158 0.38
159 0.43
160 0.51
161 0.61
162 0.71
163 0.81
164 0.8
165 0.83
166 0.83
167 0.81
168 0.79
169 0.8
170 0.78
171 0.77
172 0.76
173 0.74
174 0.71
175 0.67
176 0.7
177 0.69
178 0.72
179 0.73
180 0.75
181 0.8
182 0.85
183 0.87
184 0.81
185 0.77
186 0.75
187 0.74
188 0.69
189 0.65
190 0.56
191 0.51
192 0.54
193 0.48
194 0.43
195 0.33
196 0.28
197 0.22
198 0.25
199 0.24
200 0.18
201 0.2
202 0.19
203 0.22
204 0.22
205 0.25
206 0.23
207 0.23
208 0.26
209 0.26
210 0.3
211 0.27
212 0.27
213 0.24
214 0.24
215 0.27