Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2NZD7

Protein Details
Accession A0A0D2NZD7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
2-24NVAQKPNWRNWRQAERKFKQDAHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, cyto 8, mito_nucl 8
Family & Domain DBs
Amino Acid Sequences MNVAQKPNWRNWRQAERKFKQDAHTAKRNPAPGMSRRYLVDHSRFKKALTVIVVGSWYTGPIGLTSAVQLRHNISTVKERERIFLATRMLTRYTGNYRLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.8
3 0.76
4 0.81
5 0.8
6 0.75
7 0.69
8 0.68
9 0.67
10 0.64
11 0.68
12 0.62
13 0.61
14 0.62
15 0.59
16 0.51
17 0.46
18 0.44
19 0.4
20 0.45
21 0.4
22 0.37
23 0.34
24 0.36
25 0.35
26 0.35
27 0.37
28 0.38
29 0.4
30 0.44
31 0.44
32 0.41
33 0.41
34 0.36
35 0.31
36 0.24
37 0.22
38 0.15
39 0.15
40 0.15
41 0.11
42 0.11
43 0.07
44 0.05
45 0.04
46 0.04
47 0.04
48 0.04
49 0.05
50 0.05
51 0.05
52 0.06
53 0.08
54 0.1
55 0.1
56 0.11
57 0.13
58 0.14
59 0.15
60 0.16
61 0.16
62 0.23
63 0.28
64 0.32
65 0.36
66 0.36
67 0.37
68 0.39
69 0.4
70 0.35
71 0.35
72 0.33
73 0.31
74 0.33
75 0.33
76 0.31
77 0.29
78 0.27
79 0.28
80 0.32