Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2MAC1

Protein Details
Accession A0A0D2MAC1    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
82-105DKVMLSTTNRRRNYKQKGKKRAAKHydrophilic
NLS Segment(s)
PositionSequence
91-105RRRNYKQKGKKRAAK
Subcellular Location(s) mito 15, nucl 11
Family & Domain DBs
Amino Acid Sequences TVNSSTGFSPSQLKTGRAPRLIPPIGVLPPNATAAETTAHGIIKQIELDVREAQDNLLAAKIRQAYHANQHRGPDIEYKVGDKVMLSTTNRRRNYKQKGKKRAAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.42
3 0.48
4 0.45
5 0.47
6 0.45
7 0.52
8 0.51
9 0.44
10 0.37
11 0.32
12 0.31
13 0.29
14 0.24
15 0.16
16 0.16
17 0.17
18 0.15
19 0.11
20 0.09
21 0.09
22 0.1
23 0.09
24 0.08
25 0.08
26 0.08
27 0.07
28 0.08
29 0.08
30 0.07
31 0.07
32 0.06
33 0.07
34 0.07
35 0.1
36 0.1
37 0.1
38 0.1
39 0.1
40 0.09
41 0.09
42 0.08
43 0.06
44 0.07
45 0.06
46 0.06
47 0.09
48 0.12
49 0.11
50 0.14
51 0.17
52 0.18
53 0.28
54 0.37
55 0.39
56 0.38
57 0.4
58 0.39
59 0.38
60 0.38
61 0.34
62 0.27
63 0.26
64 0.24
65 0.24
66 0.23
67 0.22
68 0.2
69 0.14
70 0.13
71 0.13
72 0.17
73 0.18
74 0.27
75 0.37
76 0.47
77 0.53
78 0.58
79 0.64
80 0.7
81 0.78
82 0.8
83 0.81
84 0.83
85 0.88