Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2L474

Protein Details
Accession A0A0D2L474    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
60-86CPGTWALPNRTRRRRRHLHVDSPRAHSHydrophilic
NLS Segment(s)
PositionSequence
72-74RRR
Subcellular Location(s) nucl 14, cyto_nucl 10, mito 8, cyto 4
Family & Domain DBs
Amino Acid Sequences MTVAGPISKQGTPCSPSTLAPAPISRDYVSADAQALRRRSKPSEMGAPVREFHKRDGVSCPGTWALPNRTRRRRRHLHVDSPRAHSKLASATLLHTRAVEFRGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.29
3 0.28
4 0.33
5 0.34
6 0.31
7 0.3
8 0.3
9 0.29
10 0.29
11 0.31
12 0.25
13 0.22
14 0.21
15 0.21
16 0.19
17 0.15
18 0.15
19 0.14
20 0.17
21 0.21
22 0.23
23 0.24
24 0.27
25 0.3
26 0.33
27 0.36
28 0.38
29 0.37
30 0.42
31 0.43
32 0.43
33 0.42
34 0.4
35 0.35
36 0.32
37 0.31
38 0.24
39 0.22
40 0.24
41 0.22
42 0.22
43 0.26
44 0.29
45 0.28
46 0.27
47 0.27
48 0.21
49 0.2
50 0.2
51 0.19
52 0.21
53 0.25
54 0.35
55 0.43
56 0.53
57 0.63
58 0.71
59 0.77
60 0.81
61 0.83
62 0.85
63 0.85
64 0.85
65 0.86
66 0.87
67 0.82
68 0.79
69 0.77
70 0.66
71 0.57
72 0.46
73 0.38
74 0.33
75 0.31
76 0.26
77 0.2
78 0.22
79 0.28
80 0.29
81 0.27
82 0.21
83 0.19
84 0.2