Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2MBN5

Protein Details
Accession A0A0D2MBN5    Localization Confidence High Confidence Score 17.6
NoLS Segment(s)
PositionSequenceProtein Nature
21-40ADAARSPRGRARPRNRISTHHydrophilic
98-118QQPPRLRRRTRGARAHPRRDABasic
NLS Segment(s)
PositionSequence
29-32GRAR
102-116RLRRRTRGARAHPRR
Subcellular Location(s) nucl 21, cyto_nucl 12.5, mito 4
Family & Domain DBs
Amino Acid Sequences MQSCSCPQPMHPNAGAPSAGADAARSPRGRARPRNRISTHAVYLYRVARASGAVVSPTRPDGASGWCFMPLRRRGPPAATASQRYLVNYDPASGAVPQQPPRLRRRTRGARAHPRRDAEAMGTPHRGASNFNCAVNGRRANNSEGGRRETVTGASESARSHRTLERAPPPIQCTASGYPAARSPRALRMRSAVSRCCAGAPVSDCLSIHARVRVGPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.38
3 0.27
4 0.25
5 0.18
6 0.16
7 0.11
8 0.1
9 0.1
10 0.14
11 0.19
12 0.18
13 0.2
14 0.27
15 0.37
16 0.46
17 0.55
18 0.62
19 0.68
20 0.74
21 0.82
22 0.79
23 0.75
24 0.73
25 0.69
26 0.62
27 0.57
28 0.51
29 0.41
30 0.42
31 0.37
32 0.31
33 0.24
34 0.2
35 0.15
36 0.14
37 0.14
38 0.11
39 0.1
40 0.09
41 0.1
42 0.1
43 0.11
44 0.12
45 0.11
46 0.1
47 0.11
48 0.11
49 0.16
50 0.17
51 0.17
52 0.17
53 0.18
54 0.19
55 0.18
56 0.25
57 0.26
58 0.3
59 0.33
60 0.37
61 0.36
62 0.39
63 0.44
64 0.41
65 0.42
66 0.39
67 0.37
68 0.35
69 0.36
70 0.34
71 0.29
72 0.24
73 0.19
74 0.18
75 0.16
76 0.15
77 0.11
78 0.11
79 0.11
80 0.1
81 0.1
82 0.11
83 0.14
84 0.16
85 0.21
86 0.25
87 0.29
88 0.36
89 0.45
90 0.45
91 0.49
92 0.57
93 0.62
94 0.68
95 0.73
96 0.76
97 0.78
98 0.83
99 0.85
100 0.8
101 0.71
102 0.63
103 0.55
104 0.45
105 0.36
106 0.32
107 0.26
108 0.23
109 0.22
110 0.2
111 0.19
112 0.19
113 0.17
114 0.13
115 0.13
116 0.2
117 0.2
118 0.2
119 0.2
120 0.21
121 0.23
122 0.27
123 0.29
124 0.23
125 0.25
126 0.27
127 0.29
128 0.34
129 0.34
130 0.34
131 0.33
132 0.35
133 0.33
134 0.31
135 0.3
136 0.25
137 0.23
138 0.19
139 0.16
140 0.13
141 0.12
142 0.13
143 0.12
144 0.15
145 0.16
146 0.15
147 0.17
148 0.19
149 0.23
150 0.26
151 0.34
152 0.39
153 0.43
154 0.45
155 0.46
156 0.46
157 0.46
158 0.43
159 0.35
160 0.33
161 0.3
162 0.3
163 0.29
164 0.26
165 0.23
166 0.27
167 0.31
168 0.26
169 0.27
170 0.27
171 0.34
172 0.42
173 0.42
174 0.4
175 0.42
176 0.49
177 0.53
178 0.56
179 0.51
180 0.46
181 0.46
182 0.44
183 0.39
184 0.33
185 0.26
186 0.25
187 0.23
188 0.25
189 0.25
190 0.25
191 0.25
192 0.26
193 0.29
194 0.25
195 0.25
196 0.25
197 0.24