Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2P7A1

Protein Details
Accession A0A0D2P7A1   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
13-33APSSGPPRRYVRKAKGSSTKAHydrophilic
NLS Segment(s)
PositionSequence
20-37RRYVRKAKGSSTKAAVKR
Subcellular Location(s) nucl 13.5, cyto_nucl 9, mito 8, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MPITFQFETGQTAPSSGPPRRYVRKAKGSSTKAAVKRAGSEQQKSTTSNKRKRGYSPCILDARDLEFNIIQEDPSMPKDRVKFINFCPPVKTWSAPFQLDETHPAPMMFSFPVAPSVVPADTTPQPPLNLGMGAPVDNAIRPPHPHRLPFHTGAQLSPNNSDHDQDQHHMPAAAPSPRRVPTCNWGTGARRVRHPPENKAATLPRMPSGVRVIARPGEWNEKGLHTPASPLSRASSEASSSAGSGSVPSSQLQVVDGEPTRPTPEEIMQRTFWNTVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.29
3 0.28
4 0.33
5 0.38
6 0.47
7 0.54
8 0.63
9 0.68
10 0.71
11 0.78
12 0.78
13 0.8
14 0.82
15 0.79
16 0.76
17 0.72
18 0.71
19 0.64
20 0.64
21 0.59
22 0.5
23 0.49
24 0.48
25 0.5
26 0.48
27 0.49
28 0.47
29 0.48
30 0.49
31 0.48
32 0.5
33 0.52
34 0.56
35 0.6
36 0.65
37 0.67
38 0.69
39 0.75
40 0.78
41 0.76
42 0.75
43 0.72
44 0.69
45 0.67
46 0.62
47 0.54
48 0.45
49 0.41
50 0.34
51 0.27
52 0.22
53 0.18
54 0.17
55 0.17
56 0.16
57 0.11
58 0.09
59 0.1
60 0.1
61 0.13
62 0.17
63 0.16
64 0.2
65 0.23
66 0.28
67 0.34
68 0.37
69 0.38
70 0.37
71 0.48
72 0.47
73 0.45
74 0.43
75 0.37
76 0.36
77 0.35
78 0.33
79 0.25
80 0.29
81 0.32
82 0.29
83 0.29
84 0.26
85 0.26
86 0.25
87 0.27
88 0.21
89 0.17
90 0.16
91 0.15
92 0.14
93 0.12
94 0.13
95 0.08
96 0.07
97 0.07
98 0.06
99 0.08
100 0.08
101 0.08
102 0.07
103 0.08
104 0.07
105 0.07
106 0.07
107 0.1
108 0.11
109 0.13
110 0.14
111 0.14
112 0.14
113 0.14
114 0.15
115 0.12
116 0.1
117 0.09
118 0.08
119 0.07
120 0.07
121 0.06
122 0.06
123 0.05
124 0.05
125 0.06
126 0.06
127 0.07
128 0.09
129 0.13
130 0.22
131 0.25
132 0.29
133 0.31
134 0.38
135 0.43
136 0.44
137 0.43
138 0.38
139 0.35
140 0.31
141 0.33
142 0.27
143 0.22
144 0.21
145 0.2
146 0.18
147 0.19
148 0.19
149 0.15
150 0.17
151 0.18
152 0.17
153 0.18
154 0.16
155 0.16
156 0.16
157 0.15
158 0.14
159 0.15
160 0.18
161 0.18
162 0.18
163 0.22
164 0.26
165 0.28
166 0.28
167 0.29
168 0.32
169 0.37
170 0.38
171 0.36
172 0.36
173 0.37
174 0.44
175 0.49
176 0.43
177 0.43
178 0.47
179 0.51
180 0.56
181 0.59
182 0.57
183 0.59
184 0.61
185 0.56
186 0.55
187 0.51
188 0.46
189 0.44
190 0.38
191 0.29
192 0.27
193 0.26
194 0.23
195 0.24
196 0.25
197 0.22
198 0.21
199 0.23
200 0.23
201 0.23
202 0.24
203 0.25
204 0.28
205 0.27
206 0.29
207 0.27
208 0.28
209 0.29
210 0.27
211 0.26
212 0.17
213 0.2
214 0.22
215 0.25
216 0.23
217 0.22
218 0.23
219 0.22
220 0.24
221 0.24
222 0.21
223 0.18
224 0.18
225 0.19
226 0.16
227 0.15
228 0.13
229 0.1
230 0.09
231 0.08
232 0.08
233 0.09
234 0.09
235 0.1
236 0.11
237 0.11
238 0.12
239 0.12
240 0.12
241 0.11
242 0.15
243 0.16
244 0.16
245 0.16
246 0.18
247 0.21
248 0.21
249 0.22
250 0.21
251 0.27
252 0.35
253 0.39
254 0.42
255 0.41
256 0.43
257 0.44