Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2PEM4

Protein Details
Accession A0A0D2PEM4    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-44MAIKIVKKRTNKFKRHQSDRYHGVKEAWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
7-45KKRTNKFKRHQSDRYHGVKEAWRKPKGIDNRVRRRFKGQ
Subcellular Location(s) nucl 14.5, mito_nucl 12.5, mito 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAIKIVKKRTNKFKRHQSDRYHGVKEAWRKPKGIDNRVRRRFKGQTAMPKIGYGSNKKTRHLLPNGLKKFLVNNVREVDLLLMHNKTFTAEIAHNVSSRNRVTILERAKVLGIKVTNAEARLRSEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.91
3 0.91
4 0.89
5 0.88
6 0.86
7 0.83
8 0.76
9 0.66
10 0.6
11 0.57
12 0.57
13 0.57
14 0.57
15 0.52
16 0.5
17 0.5
18 0.55
19 0.59
20 0.6
21 0.6
22 0.61
23 0.7
24 0.79
25 0.83
26 0.76
27 0.74
28 0.71
29 0.68
30 0.66
31 0.62
32 0.62
33 0.63
34 0.65
35 0.57
36 0.5
37 0.44
38 0.38
39 0.35
40 0.29
41 0.29
42 0.35
43 0.37
44 0.38
45 0.42
46 0.42
47 0.46
48 0.46
49 0.47
50 0.45
51 0.54
52 0.54
53 0.52
54 0.48
55 0.4
56 0.37
57 0.34
58 0.33
59 0.24
60 0.26
61 0.26
62 0.27
63 0.27
64 0.25
65 0.19
66 0.13
67 0.13
68 0.1
69 0.1
70 0.09
71 0.09
72 0.08
73 0.09
74 0.08
75 0.08
76 0.1
77 0.1
78 0.13
79 0.16
80 0.17
81 0.17
82 0.18
83 0.2
84 0.21
85 0.21
86 0.2
87 0.18
88 0.18
89 0.22
90 0.29
91 0.33
92 0.32
93 0.32
94 0.31
95 0.31
96 0.31
97 0.28
98 0.25
99 0.2
100 0.18
101 0.19
102 0.21
103 0.22
104 0.22
105 0.25
106 0.22