Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2KG60

Protein Details
Accession A0A0D2KG60    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
45-70GEPHHHKQLHKKYSHHRKYHHRKAATBasic
145-168VKNWVNKKLHRKRYEQNHNRHHVMHydrophilic
NLS Segment(s)
PositionSequence
50-65HKQLHKKYSHHRKYHH
Subcellular Location(s) extr 15, mito 6, nucl 3, cyto_mito 3
Family & Domain DBs
Amino Acid Sequences MVQIKISAPLVLAVAAVLHSTLALPQYRPTGAVLEAREPVRLRPGEPHHHKQLHKKYSHHRKYHHRKAATAAHSSAASAASGAPSAGADLPTDPSAAGGSSGAALNSAPTADAAAVSPSAGGAAEAAPLAARELYVREPLKMEHVKNWVNKKLHRKRYEQNHNRHHVMRQHQPQQPHQDQTEQQMHADDTAEAMRAGNPSANGGEAPTMSAREYYEHLMKRELHDDLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.04
5 0.04
6 0.03
7 0.04
8 0.05
9 0.08
10 0.1
11 0.11
12 0.13
13 0.17
14 0.17
15 0.18
16 0.19
17 0.18
18 0.18
19 0.22
20 0.21
21 0.21
22 0.24
23 0.24
24 0.26
25 0.24
26 0.24
27 0.27
28 0.26
29 0.25
30 0.3
31 0.37
32 0.45
33 0.53
34 0.59
35 0.61
36 0.68
37 0.71
38 0.73
39 0.76
40 0.75
41 0.73
42 0.73
43 0.74
44 0.78
45 0.84
46 0.81
47 0.79
48 0.81
49 0.85
50 0.89
51 0.87
52 0.79
53 0.71
54 0.7
55 0.7
56 0.63
57 0.56
58 0.45
59 0.36
60 0.33
61 0.31
62 0.24
63 0.15
64 0.1
65 0.06
66 0.05
67 0.04
68 0.04
69 0.04
70 0.04
71 0.03
72 0.04
73 0.04
74 0.04
75 0.04
76 0.05
77 0.06
78 0.07
79 0.07
80 0.06
81 0.06
82 0.06
83 0.06
84 0.05
85 0.04
86 0.04
87 0.04
88 0.04
89 0.04
90 0.04
91 0.04
92 0.03
93 0.03
94 0.03
95 0.03
96 0.03
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.03
107 0.03
108 0.02
109 0.02
110 0.02
111 0.03
112 0.03
113 0.03
114 0.03
115 0.03
116 0.03
117 0.03
118 0.03
119 0.03
120 0.05
121 0.06
122 0.12
123 0.13
124 0.13
125 0.14
126 0.15
127 0.23
128 0.26
129 0.26
130 0.25
131 0.31
132 0.36
133 0.41
134 0.48
135 0.48
136 0.48
137 0.54
138 0.6
139 0.64
140 0.69
141 0.71
142 0.71
143 0.73
144 0.79
145 0.84
146 0.82
147 0.82
148 0.82
149 0.82
150 0.79
151 0.73
152 0.67
153 0.63
154 0.61
155 0.6
156 0.59
157 0.61
158 0.6
159 0.63
160 0.65
161 0.68
162 0.67
163 0.62
164 0.55
165 0.51
166 0.49
167 0.52
168 0.52
169 0.42
170 0.36
171 0.33
172 0.31
173 0.25
174 0.25
175 0.17
176 0.1
177 0.1
178 0.1
179 0.08
180 0.09
181 0.09
182 0.09
183 0.1
184 0.1
185 0.1
186 0.11
187 0.12
188 0.12
189 0.11
190 0.11
191 0.11
192 0.09
193 0.11
194 0.1
195 0.1
196 0.1
197 0.12
198 0.12
199 0.13
200 0.16
201 0.2
202 0.27
203 0.3
204 0.32
205 0.36
206 0.39
207 0.41
208 0.43