Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2PA18

Protein Details
Accession A0A0D2PA18   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
71-118RQILRFCRRKTRLRRWPGARKSGNSASLCSRNRRRQPARLDNNHRPLLHydrophilic
NLS Segment(s)
PositionSequence
79-91RKTRLRRWPGARK
Subcellular Location(s) nucl 11mito 11mito_nucl 11
Family & Domain DBs
Amino Acid Sequences MRRTGAFPQGLLSLPPTKAEYLSCRARNRLCHGRSPRSRHGCTPLHKTQTGTLMEPGTLPQRVLLFPLIPRQILRFCRRKTRLRRWPGARKSGNSASLCSRNRRRQPARLDNNHRPLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.19
4 0.18
5 0.19
6 0.21
7 0.23
8 0.25
9 0.34
10 0.39
11 0.42
12 0.47
13 0.51
14 0.55
15 0.59
16 0.62
17 0.56
18 0.59
19 0.64
20 0.68
21 0.72
22 0.74
23 0.76
24 0.74
25 0.74
26 0.69
27 0.68
28 0.65
29 0.61
30 0.61
31 0.58
32 0.55
33 0.52
34 0.49
35 0.43
36 0.42
37 0.38
38 0.3
39 0.24
40 0.19
41 0.18
42 0.17
43 0.15
44 0.11
45 0.1
46 0.08
47 0.08
48 0.08
49 0.08
50 0.09
51 0.09
52 0.08
53 0.09
54 0.14
55 0.14
56 0.14
57 0.14
58 0.15
59 0.2
60 0.26
61 0.33
62 0.37
63 0.4
64 0.51
65 0.58
66 0.66
67 0.71
68 0.75
69 0.79
70 0.79
71 0.86
72 0.85
73 0.89
74 0.88
75 0.88
76 0.83
77 0.75
78 0.73
79 0.69
80 0.66
81 0.56
82 0.5
83 0.46
84 0.49
85 0.49
86 0.51
87 0.55
88 0.59
89 0.67
90 0.76
91 0.78
92 0.78
93 0.85
94 0.87
95 0.88
96 0.88
97 0.89
98 0.88