Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2Q6V4

Protein Details
Accession A0A0D2Q6V4   
Localization Confidence High
Confidence Score 17
NoLS Segment(s)
PositionSequenceProtein Nature
28-53LKKAWVEKTKIKSRWKAQKRKDGIVAHydrophilic
NLS Segment(s)
PositionSequence
10-12KRK
29-48KKAWVEKTKIKSRWKAQKRK
124-134KKHRKSGNGRN
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences MSEPSVAGKKRKNPPTFHHLPINRAVTLKKAWVEKTKIKSRWKAQKRKDGIVAAATLDTPVYGSDDRGKSPRNDDNIVYGKSSNLSGSDSEEAGVAAEPLSLRELTKQAYSRDTLHTYKADPLKKHRKSGNGRNPARAGGAAATNHGQPNMKLRMNAMLAKIKQDFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.76
3 0.76
4 0.72
5 0.72
6 0.65
7 0.61
8 0.61
9 0.57
10 0.48
11 0.43
12 0.38
13 0.32
14 0.31
15 0.31
16 0.27
17 0.28
18 0.32
19 0.38
20 0.45
21 0.49
22 0.56
23 0.62
24 0.66
25 0.71
26 0.75
27 0.76
28 0.8
29 0.83
30 0.84
31 0.84
32 0.87
33 0.84
34 0.82
35 0.78
36 0.7
37 0.6
38 0.51
39 0.42
40 0.32
41 0.25
42 0.18
43 0.12
44 0.08
45 0.06
46 0.04
47 0.04
48 0.06
49 0.06
50 0.07
51 0.13
52 0.14
53 0.16
54 0.19
55 0.22
56 0.21
57 0.27
58 0.32
59 0.3
60 0.32
61 0.31
62 0.34
63 0.36
64 0.35
65 0.29
66 0.24
67 0.19
68 0.17
69 0.17
70 0.11
71 0.07
72 0.07
73 0.07
74 0.09
75 0.1
76 0.09
77 0.09
78 0.09
79 0.08
80 0.07
81 0.06
82 0.04
83 0.03
84 0.04
85 0.03
86 0.04
87 0.05
88 0.05
89 0.05
90 0.07
91 0.08
92 0.1
93 0.14
94 0.17
95 0.18
96 0.2
97 0.23
98 0.24
99 0.27
100 0.3
101 0.28
102 0.28
103 0.28
104 0.27
105 0.31
106 0.36
107 0.37
108 0.36
109 0.45
110 0.53
111 0.58
112 0.64
113 0.64
114 0.67
115 0.71
116 0.78
117 0.79
118 0.78
119 0.76
120 0.75
121 0.71
122 0.62
123 0.53
124 0.42
125 0.32
126 0.23
127 0.22
128 0.16
129 0.16
130 0.16
131 0.16
132 0.17
133 0.17
134 0.17
135 0.15
136 0.22
137 0.28
138 0.29
139 0.28
140 0.29
141 0.34
142 0.37
143 0.39
144 0.36
145 0.37
146 0.35
147 0.4