Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2NWS7

Protein Details
Accession A0A0D2NWS7   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
86-112PAQTARQTTKPKPKNWFAKFGRPRTKKHydrophilic
NLS Segment(s)
PositionSequence
95-112KPKPKNWFAKFGRPRTKK
Subcellular Location(s) cyto 16, mito 4, pero 4, nucl 3
Family & Domain DBs
Amino Acid Sequences MEYLAGEHDVSQVLAQLASEEGAQPLPSPPPAADTGTMLAGTASEVNAPNVLAAASSVDDVRGLEEIPTAHETAAVSTPHPLGPTPAQTARQTTKPKPKNWFAKFGRPRTKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.07
4 0.07
5 0.07
6 0.07
7 0.06
8 0.06
9 0.06
10 0.07
11 0.07
12 0.08
13 0.09
14 0.1
15 0.1
16 0.1
17 0.13
18 0.15
19 0.16
20 0.15
21 0.14
22 0.15
23 0.14
24 0.13
25 0.1
26 0.08
27 0.06
28 0.06
29 0.05
30 0.04
31 0.04
32 0.05
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.03
40 0.03
41 0.03
42 0.03
43 0.04
44 0.04
45 0.03
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.05
53 0.05
54 0.07
55 0.09
56 0.09
57 0.08
58 0.09
59 0.09
60 0.09
61 0.12
62 0.1
63 0.09
64 0.11
65 0.12
66 0.11
67 0.12
68 0.11
69 0.12
70 0.14
71 0.17
72 0.21
73 0.24
74 0.27
75 0.28
76 0.34
77 0.35
78 0.41
79 0.45
80 0.5
81 0.58
82 0.62
83 0.69
84 0.72
85 0.78
86 0.81
87 0.79
88 0.8
89 0.76
90 0.79
91 0.81
92 0.82