Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2P0R4

Protein Details
Accession A0A0D2P0R4    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MSKSKNHTNHNQNKKAHKNGIRKPNSHydrophilic
NLS Segment(s)
PositionSequence
14-40KKAHKNGIRKPNSGRTRSLKGVDAKFR
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MSKSKNHTNHNQNKKAHKNGIRKPNSGRTRSLKGVDAKFRRNARYALVGSNKARLEAKQTAAAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.81
4 0.8
5 0.8
6 0.79
7 0.83
8 0.79
9 0.74
10 0.72
11 0.72
12 0.71
13 0.64
14 0.62
15 0.56
16 0.55
17 0.54
18 0.5
19 0.45
20 0.42
21 0.44
22 0.47
23 0.46
24 0.45
25 0.48
26 0.51
27 0.5
28 0.47
29 0.43
30 0.37
31 0.4
32 0.37
33 0.37
34 0.37
35 0.39
36 0.37
37 0.42
38 0.39
39 0.34
40 0.33
41 0.27
42 0.3
43 0.3
44 0.32