A0A0D2NG36

UniProt ID: A0A0D2NG36   Organism: Hypholoma sublateritium (strain FD-334 SS-4)
Gene: HYPSUDRAFT_99621   Protein: Uncharacterized protein (Fragment)
Length: 105 AA

Protein Details

• Accession: A0A0D2NG36
• Localization Confidence: Low
• Confidence Score: 7.4
• NoLS Segment(s):

  Position	Sequence	Protein Nature
  51-70	IPGIKYKREARKWRQMSTKM	Hydrophilic

• Subcellular Location(s): cysk 16, nucl 6, mito 3
• Family & Domain DBs:
  • InterPro:
    • IPR036396 Cyt_P450_sf
  • Gene Ontology:
    • GO:0020037 F:heme binding
    • GO:0005506 F:iron ion binding
    • GO:0004497 F:monooxygenase activity
    • GO:0016705 F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
• Amino Acid Sequences: LSVAYGIRILPECDPYIGLSEAGLEAIIKSATWGSYIVDFFPILKYIPSWIPGIKYKREARKWRQMSTKMVLSPFDVVKQ

NoLS Predictions per Residue - Data Table

Residue Number, Score
1, 0.17
2, 0.15
3, 0.17
4, 0.16
5, 0.14
6, 0.11
7, 0.1
8, 0.09
9, 0.08
10, 0.07
11, 0.04
12, 0.03
13, 0.04
14, 0.04
15, 0.03
16, 0.04
17, 0.04
18, 0.04
19, 0.05
20, 0.05
21, 0.05
22, 0.07
23, 0.08
24, 0.08
25, 0.08
26, 0.08
27, 0.07
28, 0.07
29, 0.08
30, 0.06
31, 0.06
32, 0.06
33, 0.07
34, 0.08
35, 0.1
36, 0.11
37, 0.11
38, 0.14
39, 0.21
40, 0.26
41, 0.28
42, 0.35
43, 0.41
44, 0.5
45, 0.59
46, 0.67
47, 0.69
48, 0.76
49, 0.79
50, 0.8
51, 0.82
52, 0.79
53, 0.76
54, 0.72
55, 0.69
56, 0.62
57, 0.56
58, 0.49
59, 0.41
60, 0.38