Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2PN21

Protein Details
Accession A0A0D2PN21   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
11-37FLPTHRTSLPRKRKRMVRPLKDPDKVAHydrophilic
NLS Segment(s)
PositionSequence
21-28RKRKRMVR
Subcellular Location(s) mito 23, cyto 2.5, cyto_nucl 2.5
Family & Domain DBs
Amino Acid Sequences MASQASTPPVFLPTHRTSLPRKRKRMVRPLKDPDKVATLHGGITVVGGLQLLDEIALTEEALMDAISNSSARWEDRALIDRIAEVSCLVLALQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.3
3 0.33
4 0.39
5 0.49
6 0.6
7 0.61
8 0.66
9 0.7
10 0.78
11 0.84
12 0.86
13 0.87
14 0.85
15 0.86
16 0.87
17 0.88
18 0.82
19 0.73
20 0.64
21 0.56
22 0.47
23 0.37
24 0.28
25 0.19
26 0.15
27 0.14
28 0.12
29 0.08
30 0.07
31 0.06
32 0.03
33 0.03
34 0.03
35 0.02
36 0.02
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.04
54 0.04
55 0.04
56 0.05
57 0.07
58 0.08
59 0.1
60 0.11
61 0.13
62 0.18
63 0.23
64 0.24
65 0.23
66 0.23
67 0.21
68 0.22
69 0.19
70 0.15
71 0.1
72 0.09
73 0.07