Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2Q5G8

Protein Details
Accession A0A0D2Q5G8    Localization Confidence High Confidence Score 18.3
NoLS Segment(s)
PositionSequenceProtein Nature
320-346KAKAEPKAKAEPKKKAAPKKKDEDVEMBasic
359-397AEEGGKKRKRAPAKAAEAKPPSKKAKPAAKAKKSKEVIEBasic
NLS Segment(s)
PositionSequence
115-133EGAEKPKKAAAKKAPKKKA
148-196PKKKASTSKKAAAKDADDEEKPKKRAPAKKAAAEPKEKVAAKKRVLKKK
250-340PKKAPKKPASKAKAEPKAKAEPKAKAAPKSKPEPKEKAEPKAKAAPKSKAEPKEKAEPKAKADPKPKAEPKAKAEPKAKAEPKKKAAPKKK
363-393GKKRKRAPAKAAEAKPPSKKAKPAAKAKKSK
Subcellular Location(s) nucl 16.5, cyto_nucl 11, cyto 4.5, cysk 2, mito 1, extr 1, E.R. 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR005819  H1/H5  
IPR001510  Znf_PARP  
IPR036957  Znf_PARP_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0030527  F:structural constituent of chromatin  
GO:0008270  F:zinc ion binding  
GO:0006334  P:nucleosome assembly  
Pfam View protein in Pfam  
PF00645  zf-PARP  
PROSITE View protein in PROSITE  
PS50064  ZF_PARP_2  
Amino Acid Sequences MAEKTTGYRLEYASSARSKCKGPKPCAGTSIPKGDLRFGTLVDVGGHNSFAWRHWGCVTKKILENAKKQFSEASELDGFEELKAEDQAKITKAWDDGAVADEDIPESARKPEAEEGAEKPKKAAAKKAPKKKAAAEDDDDEAEEEDAPKKKASTSKKAAAKDADDEEKPKKRAPAKKAAAEPKEKVAAKKRVLKKKVAAAVVVASVGVILTALSAALQVAEEDDESGEDFTKELEDVPAGSDEDDEVEEPKKAPKKPASKAKAEPKAKAEPKAKAAPKSKPEPKEKAEPKAKAAPKSKAEPKEKAEPKAKADPKPKAEPKAKAEPKAKAEPKKKAAPKKKDEDVEMDDAAAEPAAAADAEEGGKKRKRAPAKAAEAKPPSKKAKPAAKAKKSKEVIEDEEHDELDAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.34
3 0.36
4 0.39
5 0.43
6 0.5
7 0.57
8 0.61
9 0.61
10 0.68
11 0.7
12 0.72
13 0.72
14 0.68
15 0.67
16 0.63
17 0.64
18 0.58
19 0.54
20 0.49
21 0.48
22 0.43
23 0.39
24 0.33
25 0.26
26 0.24
27 0.21
28 0.21
29 0.18
30 0.17
31 0.14
32 0.13
33 0.13
34 0.1
35 0.11
36 0.11
37 0.1
38 0.18
39 0.17
40 0.19
41 0.23
42 0.32
43 0.33
44 0.4
45 0.44
46 0.43
47 0.47
48 0.52
49 0.57
50 0.57
51 0.64
52 0.65
53 0.69
54 0.62
55 0.59
56 0.55
57 0.47
58 0.46
59 0.37
60 0.34
61 0.27
62 0.27
63 0.27
64 0.24
65 0.22
66 0.15
67 0.15
68 0.09
69 0.09
70 0.1
71 0.1
72 0.1
73 0.12
74 0.15
75 0.16
76 0.17
77 0.17
78 0.18
79 0.18
80 0.18
81 0.16
82 0.14
83 0.13
84 0.13
85 0.13
86 0.1
87 0.1
88 0.08
89 0.08
90 0.07
91 0.07
92 0.06
93 0.07
94 0.08
95 0.1
96 0.11
97 0.14
98 0.17
99 0.2
100 0.22
101 0.24
102 0.26
103 0.34
104 0.37
105 0.33
106 0.3
107 0.3
108 0.33
109 0.32
110 0.38
111 0.38
112 0.47
113 0.57
114 0.68
115 0.74
116 0.75
117 0.77
118 0.74
119 0.74
120 0.69
121 0.66
122 0.59
123 0.52
124 0.48
125 0.43
126 0.36
127 0.26
128 0.19
129 0.13
130 0.09
131 0.08
132 0.1
133 0.12
134 0.13
135 0.13
136 0.14
137 0.17
138 0.25
139 0.32
140 0.39
141 0.44
142 0.51
143 0.58
144 0.6
145 0.6
146 0.56
147 0.49
148 0.42
149 0.38
150 0.33
151 0.27
152 0.28
153 0.3
154 0.34
155 0.35
156 0.33
157 0.37
158 0.42
159 0.5
160 0.54
161 0.59
162 0.59
163 0.64
164 0.69
165 0.71
166 0.68
167 0.64
168 0.58
169 0.49
170 0.49
171 0.44
172 0.4
173 0.41
174 0.43
175 0.44
176 0.52
177 0.58
178 0.62
179 0.65
180 0.67
181 0.62
182 0.61
183 0.6
184 0.52
185 0.44
186 0.34
187 0.3
188 0.24
189 0.19
190 0.12
191 0.05
192 0.04
193 0.04
194 0.03
195 0.02
196 0.02
197 0.01
198 0.02
199 0.02
200 0.02
201 0.02
202 0.02
203 0.02
204 0.02
205 0.02
206 0.02
207 0.03
208 0.03
209 0.03
210 0.03
211 0.03
212 0.04
213 0.04
214 0.04
215 0.04
216 0.04
217 0.04
218 0.05
219 0.05
220 0.05
221 0.05
222 0.05
223 0.05
224 0.06
225 0.06
226 0.06
227 0.06
228 0.06
229 0.05
230 0.06
231 0.06
232 0.05
233 0.06
234 0.07
235 0.07
236 0.08
237 0.14
238 0.19
239 0.21
240 0.29
241 0.37
242 0.46
243 0.55
244 0.65
245 0.66
246 0.68
247 0.74
248 0.76
249 0.77
250 0.72
251 0.67
252 0.62
253 0.66
254 0.62
255 0.62
256 0.58
257 0.52
258 0.54
259 0.59
260 0.58
261 0.57
262 0.59
263 0.59
264 0.6
265 0.65
266 0.68
267 0.67
268 0.71
269 0.71
270 0.69
271 0.72
272 0.72
273 0.72
274 0.73
275 0.67
276 0.64
277 0.65
278 0.66
279 0.63
280 0.64
281 0.62
282 0.58
283 0.63
284 0.66
285 0.66
286 0.68
287 0.67
288 0.65
289 0.68
290 0.69
291 0.68
292 0.68
293 0.64
294 0.63
295 0.66
296 0.68
297 0.66
298 0.68
299 0.69
300 0.68
301 0.74
302 0.75
303 0.74
304 0.75
305 0.74
306 0.72
307 0.75
308 0.74
309 0.72
310 0.71
311 0.69
312 0.68
313 0.69
314 0.71
315 0.7
316 0.72
317 0.74
318 0.76
319 0.78
320 0.8
321 0.82
322 0.84
323 0.85
324 0.86
325 0.85
326 0.86
327 0.82
328 0.76
329 0.72
330 0.68
331 0.61
332 0.51
333 0.42
334 0.33
335 0.27
336 0.23
337 0.15
338 0.09
339 0.04
340 0.04
341 0.04
342 0.04
343 0.03
344 0.03
345 0.04
346 0.05
347 0.08
348 0.1
349 0.17
350 0.22
351 0.26
352 0.33
353 0.42
354 0.52
355 0.59
356 0.68
357 0.71
358 0.78
359 0.84
360 0.82
361 0.83
362 0.8
363 0.78
364 0.75
365 0.73
366 0.71
367 0.68
368 0.71
369 0.71
370 0.74
371 0.76
372 0.79
373 0.82
374 0.84
375 0.88
376 0.87
377 0.87
378 0.82
379 0.78
380 0.75
381 0.71
382 0.67
383 0.64
384 0.62
385 0.56
386 0.52
387 0.46