Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2KD75

Protein Details
Accession A0A0D2KD75    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
181-207TDTSESKVKPKKPRKAKKVVPKDRVARBasic
364-385AQPTPREPIRPRARAKVRKTISHydrophilic
NLS Segment(s)
PositionSequence
187-203KVKPKKPRKAKKVVPKX
372-387PREPIRPRARAKVRKT
Subcellular Location(s) cyto 12, cyto_nucl 11.833, mito_nucl 7.832, nucl 7.5, mito 6.5
Family & Domain DBs
Amino Acid Sequences MPSFESKYERQLLQLKLELKAYIQSVREAANLPADVPSDKVFLKYDEAGFPVLIGFNPSKPLLKTEVEQLIREYLSRHYFLANGNIGDGNKGPPYARIQRQQSRYIASKYLPKDFVLIEPRNLKLADGLAFLKHIHERQATNKAPNVFRFEKVATSRKADEAGKLRPAHYPDDSSDAPMSTDTSESKVKPKKPRKAKKVVPKXDRVARTLQKEMEGLLILAEPQVADAANATAQDTEPPLAVASQPDHPQYVITNGPNDPIPPGPGIFAIPANAVVGAQLQEVALPRREFTGVIDPALIGLRAEPPPQLITPRPSVTPNMSPVKQETFLEATITAAXVXSTAVNXKAKAVSKRPQLPSIAEGSVGRAAQPTPREPIRPRARAKVRKTISPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.46
3 0.42
4 0.43
5 0.37
6 0.3
7 0.29
8 0.26
9 0.24
10 0.23
11 0.23
12 0.23
13 0.24
14 0.25
15 0.23
16 0.21
17 0.21
18 0.2
19 0.18
20 0.18
21 0.18
22 0.16
23 0.16
24 0.17
25 0.15
26 0.15
27 0.17
28 0.17
29 0.17
30 0.21
31 0.23
32 0.24
33 0.23
34 0.24
35 0.23
36 0.21
37 0.19
38 0.15
39 0.12
40 0.1
41 0.11
42 0.11
43 0.11
44 0.14
45 0.15
46 0.18
47 0.18
48 0.22
49 0.24
50 0.25
51 0.26
52 0.3
53 0.37
54 0.36
55 0.36
56 0.34
57 0.31
58 0.29
59 0.28
60 0.22
61 0.19
62 0.22
63 0.22
64 0.22
65 0.19
66 0.21
67 0.23
68 0.28
69 0.24
70 0.2
71 0.2
72 0.2
73 0.2
74 0.19
75 0.18
76 0.13
77 0.11
78 0.12
79 0.11
80 0.13
81 0.2
82 0.28
83 0.34
84 0.41
85 0.49
86 0.57
87 0.63
88 0.67
89 0.63
90 0.6
91 0.58
92 0.53
93 0.47
94 0.41
95 0.43
96 0.39
97 0.42
98 0.38
99 0.33
100 0.32
101 0.29
102 0.32
103 0.33
104 0.31
105 0.29
106 0.31
107 0.31
108 0.31
109 0.31
110 0.25
111 0.17
112 0.17
113 0.14
114 0.13
115 0.13
116 0.11
117 0.11
118 0.11
119 0.12
120 0.13
121 0.12
122 0.15
123 0.18
124 0.2
125 0.25
126 0.34
127 0.36
128 0.37
129 0.4
130 0.41
131 0.4
132 0.41
133 0.43
134 0.36
135 0.33
136 0.33
137 0.3
138 0.31
139 0.33
140 0.36
141 0.31
142 0.32
143 0.33
144 0.3
145 0.33
146 0.29
147 0.29
148 0.28
149 0.29
150 0.31
151 0.31
152 0.31
153 0.31
154 0.32
155 0.31
156 0.27
157 0.26
158 0.2
159 0.25
160 0.24
161 0.22
162 0.2
163 0.17
164 0.15
165 0.13
166 0.13
167 0.07
168 0.08
169 0.07
170 0.09
171 0.12
172 0.13
173 0.21
174 0.27
175 0.34
176 0.44
177 0.53
178 0.61
179 0.69
180 0.79
181 0.81
182 0.86
183 0.87
184 0.87
185 0.89
186 0.89
187 0.85
188 0.82
189 0.8
190 0.73
191 0.7
192 0.63
193 0.6
194 0.54
195 0.54
196 0.47
197 0.41
198 0.36
199 0.31
200 0.28
201 0.2
202 0.15
203 0.07
204 0.06
205 0.05
206 0.05
207 0.04
208 0.03
209 0.03
210 0.03
211 0.03
212 0.03
213 0.03
214 0.03
215 0.04
216 0.04
217 0.04
218 0.04
219 0.05
220 0.05
221 0.06
222 0.06
223 0.06
224 0.06
225 0.06
226 0.06
227 0.06
228 0.07
229 0.08
230 0.11
231 0.13
232 0.13
233 0.14
234 0.14
235 0.14
236 0.13
237 0.15
238 0.15
239 0.14
240 0.16
241 0.16
242 0.17
243 0.16
244 0.16
245 0.15
246 0.12
247 0.12
248 0.1
249 0.1
250 0.1
251 0.1
252 0.1
253 0.1
254 0.09
255 0.08
256 0.08
257 0.07
258 0.07
259 0.06
260 0.06
261 0.05
262 0.05
263 0.05
264 0.05
265 0.05
266 0.04
267 0.05
268 0.07
269 0.1
270 0.14
271 0.14
272 0.14
273 0.16
274 0.17
275 0.16
276 0.18
277 0.24
278 0.21
279 0.21
280 0.21
281 0.19
282 0.19
283 0.19
284 0.15
285 0.06
286 0.06
287 0.09
288 0.1
289 0.11
290 0.11
291 0.12
292 0.15
293 0.16
294 0.2
295 0.21
296 0.24
297 0.3
298 0.31
299 0.32
300 0.32
301 0.35
302 0.36
303 0.36
304 0.39
305 0.4
306 0.39
307 0.39
308 0.4
309 0.42
310 0.38
311 0.33
312 0.31
313 0.27
314 0.26
315 0.25
316 0.21
317 0.17
318 0.15
319 0.15
320 0.1
321 0.07
322 0.07
323 0.06
324 0.07
325 0.11
326 0.13
327 0.14
328 0.14
329 0.16
330 0.23
331 0.29
332 0.36
333 0.4
334 0.47
335 0.56
336 0.61
337 0.65
338 0.62
339 0.59
340 0.56
341 0.52
342 0.43
343 0.35
344 0.29
345 0.26
346 0.25
347 0.21
348 0.18
349 0.14
350 0.15
351 0.19
352 0.24
353 0.24
354 0.29
355 0.34
356 0.41
357 0.44
358 0.55
359 0.6
360 0.64
361 0.68
362 0.71
363 0.78
364 0.8
365 0.84
366 0.84
367 0.78