Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2L2W5

Protein Details
Accession A0A0D2L2W5    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
9-28LPPRCHRCSHGCVRRRVRHABasic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito 11, cyto_nucl 9, cyto 3.5
Family & Domain DBs
Amino Acid Sequences VQPDLSLQLPPRCHRCSHGCVRRRVRHALRCGWIHQDASRCLPFPPSWRSPREVTLRLDTSHISIIYGSRLLTLTSFSSFSDILCLVESLEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.49
3 0.52
4 0.58
5 0.63
6 0.63
7 0.7
8 0.79
9 0.81
10 0.78
11 0.8
12 0.78
13 0.77
14 0.77
15 0.74
16 0.69
17 0.63
18 0.59
19 0.54
20 0.46
21 0.39
22 0.33
23 0.3
24 0.26
25 0.27
26 0.26
27 0.22
28 0.2
29 0.21
30 0.2
31 0.21
32 0.25
33 0.28
34 0.32
35 0.34
36 0.37
37 0.37
38 0.42
39 0.44
40 0.42
41 0.39
42 0.39
43 0.39
44 0.36
45 0.35
46 0.29
47 0.24
48 0.21
49 0.18
50 0.12
51 0.1
52 0.1
53 0.1
54 0.1
55 0.09
56 0.08
57 0.08
58 0.08
59 0.08
60 0.09
61 0.1
62 0.11
63 0.12
64 0.11
65 0.13
66 0.13
67 0.13
68 0.14
69 0.13
70 0.12
71 0.12
72 0.12