Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2P487

Protein Details
Accession A0A0D2P487   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
89-118STPPVVKKKGSGKGKSKKRAKSQKAAKKRPBasic
NLS Segment(s)
PositionSequence
94-118VKKKGSGKGKSKKRAKSQKAAKKRP
Subcellular Location(s) extr 12, mito 5, plas 5, cyto 2.5, cyto_nucl 2.5
Family & Domain DBs
Amino Acid Sequences MDTVDPRFNRPAPSPFKRAGLLLLIAALVWIALQMRSGLLEAKRKPQIIYASRYSKEHKYRPAASPIITETLKDGRIRLRGAIAPTATSTPPVVKKKGSGKGKSKKRAKSQKAAKKRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.53
3 0.54
4 0.5
5 0.45
6 0.38
7 0.31
8 0.25
9 0.19
10 0.16
11 0.12
12 0.1
13 0.09
14 0.06
15 0.03
16 0.02
17 0.02
18 0.03
19 0.03
20 0.03
21 0.04
22 0.04
23 0.04
24 0.05
25 0.08
26 0.1
27 0.18
28 0.19
29 0.26
30 0.31
31 0.31
32 0.31
33 0.33
34 0.39
35 0.36
36 0.4
37 0.4
38 0.42
39 0.42
40 0.44
41 0.42
42 0.42
43 0.45
44 0.45
45 0.45
46 0.46
47 0.5
48 0.51
49 0.54
50 0.47
51 0.4
52 0.36
53 0.3
54 0.27
55 0.22
56 0.19
57 0.14
58 0.15
59 0.16
60 0.15
61 0.15
62 0.16
63 0.2
64 0.21
65 0.2
66 0.21
67 0.21
68 0.23
69 0.25
70 0.21
71 0.18
72 0.18
73 0.19
74 0.16
75 0.14
76 0.13
77 0.14
78 0.22
79 0.27
80 0.29
81 0.29
82 0.36
83 0.44
84 0.53
85 0.58
86 0.6
87 0.66
88 0.73
89 0.82
90 0.86
91 0.86
92 0.86
93 0.88
94 0.9
95 0.89
96 0.89
97 0.9
98 0.9