Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2P2K3

Protein Details
Accession A0A0D2P2K3   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
51-70AYGDRKRPPARVHRRVVTKPBasic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 12.333, cyto 6, cyto_mito 4.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
IPR040976  Pkinase_fungal  
Pfam View protein in Pfam  
PF17667  Pkinase_fungal  
Amino Acid Sequences MEPFSEIRHLLTISVKIQADPKARKSLKHRYPLLIVXQELDDNTLARRTGLAYGDRKRPPARVHRRVVTKPIGDPLTSFRSKYELCSVFCDVVDFLKFSSGKCSVCHGDISMHNIVINRDLNSGAESDLTPLSSSNSSTVKFPATAAQPSTSNPGSATIKGYGLVIDFDNAFSVTEVLKNGYKINSGTVPYMAIESLSHTKKTQFCHQPKHDLESLFYVLLTLCTYTTGPGCLRSHIPLADESSICMNRWWSLVQDQHELARHKAAMVSCLDKNITSRFAPYWKDFIPYIEELRSTLWPDATPVQAQENVATHDGFLKVLTKARDKYKHDEEAASPLEYAPVAKKARQKASIRKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.24
4 0.28
5 0.33
6 0.39
7 0.43
8 0.47
9 0.52
10 0.54
11 0.6
12 0.65
13 0.69
14 0.7
15 0.72
16 0.73
17 0.68
18 0.72
19 0.71
20 0.68
21 0.62
22 0.53
23 0.44
24 0.42
25 0.36
26 0.31
27 0.25
28 0.19
29 0.14
30 0.16
31 0.15
32 0.11
33 0.11
34 0.11
35 0.14
36 0.18
37 0.24
38 0.3
39 0.36
40 0.45
41 0.48
42 0.53
43 0.52
44 0.55
45 0.57
46 0.61
47 0.66
48 0.67
49 0.72
50 0.74
51 0.8
52 0.79
53 0.78
54 0.75
55 0.67
56 0.59
57 0.57
58 0.5
59 0.41
60 0.37
61 0.34
62 0.33
63 0.31
64 0.29
65 0.23
66 0.27
67 0.27
68 0.29
69 0.34
70 0.31
71 0.31
72 0.36
73 0.38
74 0.33
75 0.33
76 0.3
77 0.21
78 0.17
79 0.17
80 0.12
81 0.1
82 0.14
83 0.14
84 0.13
85 0.19
86 0.2
87 0.21
88 0.21
89 0.26
90 0.23
91 0.24
92 0.25
93 0.2
94 0.21
95 0.21
96 0.26
97 0.21
98 0.19
99 0.19
100 0.19
101 0.18
102 0.18
103 0.18
104 0.14
105 0.13
106 0.14
107 0.13
108 0.13
109 0.13
110 0.09
111 0.08
112 0.07
113 0.08
114 0.08
115 0.08
116 0.07
117 0.07
118 0.08
119 0.08
120 0.09
121 0.1
122 0.12
123 0.12
124 0.13
125 0.14
126 0.14
127 0.13
128 0.13
129 0.15
130 0.15
131 0.17
132 0.17
133 0.17
134 0.17
135 0.17
136 0.21
137 0.17
138 0.15
139 0.13
140 0.15
141 0.15
142 0.15
143 0.17
144 0.13
145 0.13
146 0.13
147 0.13
148 0.09
149 0.08
150 0.08
151 0.06
152 0.05
153 0.05
154 0.05
155 0.05
156 0.05
157 0.05
158 0.04
159 0.05
160 0.04
161 0.05
162 0.06
163 0.07
164 0.07
165 0.08
166 0.09
167 0.09
168 0.1
169 0.1
170 0.11
171 0.12
172 0.12
173 0.12
174 0.11
175 0.11
176 0.1
177 0.1
178 0.08
179 0.06
180 0.05
181 0.07
182 0.12
183 0.13
184 0.14
185 0.14
186 0.19
187 0.22
188 0.27
189 0.34
190 0.39
191 0.46
192 0.55
193 0.59
194 0.65
195 0.63
196 0.65
197 0.59
198 0.49
199 0.43
200 0.36
201 0.32
202 0.22
203 0.2
204 0.14
205 0.1
206 0.1
207 0.09
208 0.05
209 0.04
210 0.05
211 0.05
212 0.06
213 0.07
214 0.09
215 0.09
216 0.14
217 0.15
218 0.16
219 0.17
220 0.19
221 0.21
222 0.19
223 0.2
224 0.16
225 0.18
226 0.19
227 0.17
228 0.16
229 0.17
230 0.18
231 0.17
232 0.16
233 0.14
234 0.12
235 0.14
236 0.14
237 0.12
238 0.17
239 0.21
240 0.24
241 0.27
242 0.26
243 0.28
244 0.33
245 0.33
246 0.28
247 0.27
248 0.24
249 0.21
250 0.23
251 0.21
252 0.18
253 0.19
254 0.21
255 0.18
256 0.2
257 0.2
258 0.18
259 0.2
260 0.2
261 0.21
262 0.17
263 0.2
264 0.21
265 0.25
266 0.3
267 0.3
268 0.33
269 0.3
270 0.33
271 0.31
272 0.3
273 0.31
274 0.28
275 0.28
276 0.24
277 0.23
278 0.21
279 0.23
280 0.23
281 0.19
282 0.18
283 0.17
284 0.15
285 0.18
286 0.2
287 0.2
288 0.2
289 0.18
290 0.2
291 0.21
292 0.21
293 0.21
294 0.2
295 0.2
296 0.2
297 0.19
298 0.16
299 0.16
300 0.16
301 0.14
302 0.13
303 0.12
304 0.13
305 0.18
306 0.22
307 0.27
308 0.33
309 0.43
310 0.52
311 0.55
312 0.63
313 0.67
314 0.71
315 0.68
316 0.66
317 0.58
318 0.57
319 0.53
320 0.45
321 0.36
322 0.27
323 0.24
324 0.2
325 0.19
326 0.14
327 0.19
328 0.22
329 0.27
330 0.35
331 0.43
332 0.52
333 0.6
334 0.67