Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2PDE1

Protein Details
Accession A0A0D2PDE1   
Localization Confidence Medium
Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
99-127GLAPRPYLRVRPPRRRKRRRGAWGIPACQHydrophilic
153-172APCTRACRRRRSAALRHGESHydrophilic
NLS Segment(s)
PositionSequence
105-152YLRVRPPRRRKRRRGAWGIPACQVARRRTGRGPRRAGAWRRSGRYARG
Subcellular Location(s) mito 12, nucl 10, cyto 3
Family & Domain DBs
Amino Acid Sequences MYAIPTRSGRSYRPSSTDWNVRNPVQCCSRDAGVGRITQDILAFDALLSAHRALGTPRPASRCPAAATARNSAGPPNRVPAGPISDFARGWGRGTPSTGLAPRPYLRVRPPRRRKRRRGAWGIPACQVARRRTGRGPRRAGAWRRSGRYARGAPCTRACRRRRSAALRHGESACGGGAPGVAHAVPPHELGVHGRQIFELVVLACARA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.52
3 0.56
4 0.62
5 0.57
6 0.58
7 0.58
8 0.57
9 0.6
10 0.54
11 0.53
12 0.5
13 0.48
14 0.42
15 0.41
16 0.38
17 0.35
18 0.35
19 0.33
20 0.29
21 0.3
22 0.28
23 0.24
24 0.23
25 0.2
26 0.19
27 0.14
28 0.12
29 0.1
30 0.08
31 0.06
32 0.07
33 0.06
34 0.06
35 0.08
36 0.07
37 0.07
38 0.07
39 0.07
40 0.08
41 0.14
42 0.19
43 0.21
44 0.25
45 0.29
46 0.31
47 0.34
48 0.35
49 0.32
50 0.29
51 0.32
52 0.32
53 0.33
54 0.35
55 0.35
56 0.34
57 0.32
58 0.29
59 0.27
60 0.27
61 0.25
62 0.22
63 0.22
64 0.22
65 0.21
66 0.21
67 0.19
68 0.21
69 0.18
70 0.18
71 0.17
72 0.18
73 0.17
74 0.18
75 0.19
76 0.14
77 0.14
78 0.15
79 0.15
80 0.14
81 0.16
82 0.16
83 0.13
84 0.15
85 0.15
86 0.14
87 0.13
88 0.14
89 0.14
90 0.17
91 0.17
92 0.18
93 0.25
94 0.34
95 0.44
96 0.53
97 0.63
98 0.71
99 0.81
100 0.89
101 0.92
102 0.93
103 0.94
104 0.93
105 0.93
106 0.89
107 0.88
108 0.84
109 0.76
110 0.67
111 0.58
112 0.47
113 0.41
114 0.39
115 0.3
116 0.31
117 0.32
118 0.34
119 0.4
120 0.5
121 0.56
122 0.6
123 0.65
124 0.58
125 0.6
126 0.65
127 0.65
128 0.62
129 0.63
130 0.59
131 0.57
132 0.62
133 0.59
134 0.54
135 0.55
136 0.55
137 0.5
138 0.53
139 0.52
140 0.5
141 0.54
142 0.58
143 0.58
144 0.61
145 0.62
146 0.63
147 0.67
148 0.72
149 0.75
150 0.77
151 0.78
152 0.79
153 0.83
154 0.76
155 0.73
156 0.64
157 0.55
158 0.45
159 0.36
160 0.26
161 0.15
162 0.11
163 0.07
164 0.07
165 0.06
166 0.06
167 0.06
168 0.05
169 0.06
170 0.06
171 0.08
172 0.09
173 0.09
174 0.1
175 0.09
176 0.1
177 0.14
178 0.19
179 0.24
180 0.24
181 0.23
182 0.23
183 0.24
184 0.23
185 0.19
186 0.16
187 0.09
188 0.11