Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2P466

Protein Details
Accession A0A0D2P466   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
23-48LASMPTPPRTHRRHARGRSRGSCDSDHydrophilic
NLS Segment(s)
PositionSequence
34-38RRHAR
273-284RRAARAKGKSAS
294-310GGAKAKGGAKTKVRRAR
Subcellular Location(s) mito 16, nucl 7.5, cyto_nucl 5.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MLDSSPAPITRRPLKRSASAASLASMPTPPRTHRRHARGRSRGSCDSDSDDHADDHEDVVVTTDEEADEDAHRAKKRRTGPAAAAADEDAFWLSGATDGPSTTTTTTTAGGAATRSAKAQAPVAPPPLLYRKKAQGQSGEVAPVSPPPSHRRAVAIAPVTPEPPRTRAAARRALRDSPANPFLASPADPATDSATPSPIAGSSTVSPKTPTMGEKPTMTYVFRGVRRVYQNPLYDHGAGRARSPPAASLLPIEDPEYSPAINCTPKMLFPAARRAARAKGKSASGATAAATMLGGAKAKGGAKTKVRRARSPSLSGDELDAADLRPRKLAFGKRTLGEELVSAGEPLAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.64
3 0.67
4 0.64
5 0.6
6 0.54
7 0.49
8 0.41
9 0.36
10 0.29
11 0.24
12 0.21
13 0.17
14 0.19
15 0.23
16 0.27
17 0.35
18 0.42
19 0.51
20 0.6
21 0.69
22 0.74
23 0.81
24 0.86
25 0.87
26 0.91
27 0.9
28 0.87
29 0.84
30 0.8
31 0.72
32 0.64
33 0.6
34 0.52
35 0.46
36 0.41
37 0.35
38 0.28
39 0.26
40 0.25
41 0.19
42 0.17
43 0.14
44 0.11
45 0.09
46 0.11
47 0.11
48 0.08
49 0.08
50 0.08
51 0.07
52 0.07
53 0.07
54 0.07
55 0.07
56 0.09
57 0.12
58 0.17
59 0.22
60 0.27
61 0.31
62 0.38
63 0.46
64 0.55
65 0.58
66 0.6
67 0.61
68 0.65
69 0.64
70 0.56
71 0.48
72 0.38
73 0.31
74 0.24
75 0.19
76 0.09
77 0.06
78 0.05
79 0.05
80 0.04
81 0.05
82 0.05
83 0.06
84 0.06
85 0.06
86 0.07
87 0.08
88 0.09
89 0.09
90 0.1
91 0.1
92 0.11
93 0.11
94 0.1
95 0.1
96 0.09
97 0.08
98 0.08
99 0.09
100 0.09
101 0.09
102 0.09
103 0.1
104 0.12
105 0.12
106 0.15
107 0.18
108 0.2
109 0.22
110 0.25
111 0.23
112 0.22
113 0.24
114 0.31
115 0.29
116 0.28
117 0.29
118 0.33
119 0.41
120 0.45
121 0.46
122 0.43
123 0.43
124 0.43
125 0.4
126 0.34
127 0.26
128 0.22
129 0.18
130 0.14
131 0.12
132 0.1
133 0.12
134 0.16
135 0.2
136 0.21
137 0.22
138 0.23
139 0.23
140 0.25
141 0.27
142 0.24
143 0.21
144 0.21
145 0.21
146 0.19
147 0.17
148 0.18
149 0.14
150 0.15
151 0.16
152 0.16
153 0.2
154 0.26
155 0.32
156 0.39
157 0.4
158 0.44
159 0.46
160 0.45
161 0.43
162 0.4
163 0.34
164 0.3
165 0.3
166 0.24
167 0.21
168 0.19
169 0.18
170 0.16
171 0.14
172 0.1
173 0.08
174 0.08
175 0.08
176 0.08
177 0.1
178 0.1
179 0.1
180 0.1
181 0.1
182 0.09
183 0.09
184 0.09
185 0.06
186 0.06
187 0.06
188 0.07
189 0.08
190 0.11
191 0.12
192 0.12
193 0.13
194 0.13
195 0.14
196 0.14
197 0.16
198 0.17
199 0.21
200 0.22
201 0.23
202 0.25
203 0.26
204 0.26
205 0.23
206 0.19
207 0.2
208 0.24
209 0.25
210 0.26
211 0.25
212 0.3
213 0.35
214 0.38
215 0.38
216 0.39
217 0.42
218 0.4
219 0.43
220 0.4
221 0.35
222 0.32
223 0.31
224 0.29
225 0.24
226 0.24
227 0.24
228 0.22
229 0.21
230 0.22
231 0.18
232 0.18
233 0.18
234 0.17
235 0.14
236 0.14
237 0.14
238 0.14
239 0.14
240 0.11
241 0.11
242 0.13
243 0.12
244 0.11
245 0.1
246 0.11
247 0.13
248 0.15
249 0.14
250 0.16
251 0.16
252 0.17
253 0.2
254 0.22
255 0.24
256 0.25
257 0.36
258 0.39
259 0.4
260 0.42
261 0.42
262 0.47
263 0.51
264 0.51
265 0.47
266 0.44
267 0.44
268 0.46
269 0.44
270 0.37
271 0.29
272 0.26
273 0.21
274 0.17
275 0.15
276 0.11
277 0.09
278 0.07
279 0.06
280 0.06
281 0.06
282 0.05
283 0.06
284 0.08
285 0.1
286 0.15
287 0.19
288 0.26
289 0.35
290 0.44
291 0.54
292 0.61
293 0.66
294 0.7
295 0.73
296 0.77
297 0.75
298 0.74
299 0.7
300 0.67
301 0.62
302 0.54
303 0.48
304 0.38
305 0.3
306 0.24
307 0.18
308 0.13
309 0.16
310 0.19
311 0.18
312 0.22
313 0.22
314 0.25
315 0.33
316 0.42
317 0.45
318 0.51
319 0.56
320 0.54
321 0.58
322 0.56
323 0.5
324 0.4
325 0.32
326 0.25
327 0.2
328 0.18
329 0.14