Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2NWV8

Protein Details
Accession A0A0D2NWV8   
Localization Confidence High
Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MRADRFARSRGRRKARTSTTSARHydrophilic
NLS Segment(s)
PositionSequence
10-14RGRRK
88-122GSRGPPSAARRGTRRARTRGAAGTRRGPRQPRSPR
Subcellular Location(s) nucl 20, cyto_nucl 12, mito 5
Family & Domain DBs
Amino Acid Sequences MRADRFARSRGRRKARTSTTSARATPDSSGCSPHAASAPTPRTALFIARQPRRLPQSQERNESQKTHQARSPCAARCAASTPGARGTGSRGPPSAARRGTRRARTRGAAGTRRGPRQPRSPRCARTGRCTGTRRSPSIVGQARRHARFIYSPGAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.85
3 0.83
4 0.81
5 0.79
6 0.76
7 0.73
8 0.66
9 0.59
10 0.51
11 0.45
12 0.39
13 0.33
14 0.3
15 0.25
16 0.27
17 0.24
18 0.24
19 0.23
20 0.21
21 0.21
22 0.18
23 0.18
24 0.24
25 0.26
26 0.25
27 0.25
28 0.24
29 0.23
30 0.23
31 0.24
32 0.17
33 0.21
34 0.28
35 0.32
36 0.37
37 0.36
38 0.42
39 0.45
40 0.48
41 0.49
42 0.5
43 0.57
44 0.59
45 0.64
46 0.62
47 0.62
48 0.59
49 0.55
50 0.47
51 0.44
52 0.41
53 0.38
54 0.36
55 0.33
56 0.33
57 0.34
58 0.38
59 0.31
60 0.3
61 0.28
62 0.26
63 0.24
64 0.25
65 0.22
66 0.2
67 0.18
68 0.17
69 0.18
70 0.18
71 0.17
72 0.13
73 0.16
74 0.18
75 0.19
76 0.2
77 0.18
78 0.19
79 0.23
80 0.26
81 0.29
82 0.28
83 0.3
84 0.33
85 0.41
86 0.49
87 0.55
88 0.6
89 0.59
90 0.61
91 0.6
92 0.61
93 0.6
94 0.6
95 0.57
96 0.52
97 0.54
98 0.54
99 0.56
100 0.58
101 0.57
102 0.55
103 0.59
104 0.67
105 0.68
106 0.7
107 0.75
108 0.74
109 0.76
110 0.8
111 0.74
112 0.71
113 0.71
114 0.69
115 0.68
116 0.67
117 0.65
118 0.66
119 0.69
120 0.64
121 0.59
122 0.56
123 0.5
124 0.56
125 0.58
126 0.55
127 0.53
128 0.59
129 0.63
130 0.61
131 0.61
132 0.52
133 0.47
134 0.45
135 0.44