Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2P538

Protein Details
Accession A0A0D2P538   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
107-139AEHPADSRRHAQRRCPRWRPPWRIRGRPQRRGSBasic
NLS Segment(s)
PositionSequence
115-139RHAQRRCPRWRPPWRIRGRPQRRGS
Subcellular Location(s) nucl 11, cyto 9, mito 4, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR029048  HSP70_C_sf  
IPR013126  Hsp_70_fam  
Gene Ontology GO:0005524  F:ATP binding  
GO:0140662  F:ATP-dependent protein folding chaperone  
Pfam View protein in Pfam  
PF00012  HSP70  
Amino Acid Sequences GHLSREGIGRMVNEADKYSAEDEHAAARITSNNTLESYSYNLPKYLNDEKLAGKFEAGDKTQLETAVNETIAWLDTSQMGSKEGYEEKQKELEAITNPVIQKLYGWAEHPADSRRHAQRRCPRWRPPWRIRGRPQRRGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.17
5 0.17
6 0.15
7 0.14
8 0.14
9 0.14
10 0.14
11 0.15
12 0.13
13 0.11
14 0.12
15 0.14
16 0.15
17 0.18
18 0.17
19 0.17
20 0.17
21 0.18
22 0.17
23 0.15
24 0.17
25 0.17
26 0.19
27 0.19
28 0.19
29 0.19
30 0.19
31 0.25
32 0.27
33 0.26
34 0.25
35 0.26
36 0.27
37 0.29
38 0.31
39 0.24
40 0.17
41 0.15
42 0.16
43 0.17
44 0.16
45 0.15
46 0.13
47 0.15
48 0.15
49 0.15
50 0.13
51 0.1
52 0.11
53 0.09
54 0.09
55 0.07
56 0.07
57 0.07
58 0.06
59 0.06
60 0.04
61 0.04
62 0.04
63 0.05
64 0.06
65 0.06
66 0.07
67 0.07
68 0.07
69 0.09
70 0.1
71 0.11
72 0.17
73 0.19
74 0.2
75 0.22
76 0.22
77 0.2
78 0.2
79 0.21
80 0.17
81 0.19
82 0.18
83 0.19
84 0.19
85 0.2
86 0.19
87 0.15
88 0.13
89 0.13
90 0.15
91 0.12
92 0.14
93 0.16
94 0.18
95 0.2
96 0.23
97 0.23
98 0.24
99 0.26
100 0.33
101 0.39
102 0.47
103 0.5
104 0.58
105 0.64
106 0.73
107 0.8
108 0.82
109 0.82
110 0.84
111 0.9
112 0.91
113 0.91
114 0.91
115 0.91
116 0.92
117 0.92
118 0.93
119 0.92