Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2N0W0

Protein Details
Accession A0A0D2N0W0    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
39-65SPVGAQVRRARRKRWCRHRRCAPGTLRHydrophilic
NLS Segment(s)
PositionSequence
47-52RARRKR
Subcellular Location(s) nucl 14, extr 5, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
Amino Acid Sequences MGTAAASPLARPPLTDSATLTLCAMAHPSPTTALIHHLSPVGAQVRRARRKRWCRHRRCAPGTLRIGDRLSSSESDAASGQQVYLQLRSFTADGDGCYVYRHEATRPAAKIHHPSTFEDNAPPLPLLGLQDCCKAPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.28
4 0.27
5 0.28
6 0.28
7 0.22
8 0.16
9 0.13
10 0.12
11 0.12
12 0.09
13 0.1
14 0.1
15 0.1
16 0.11
17 0.12
18 0.13
19 0.11
20 0.15
21 0.15
22 0.14
23 0.14
24 0.14
25 0.12
26 0.11
27 0.14
28 0.14
29 0.13
30 0.16
31 0.22
32 0.32
33 0.42
34 0.47
35 0.52
36 0.58
37 0.69
38 0.77
39 0.81
40 0.83
41 0.84
42 0.9
43 0.93
44 0.93
45 0.88
46 0.86
47 0.8
48 0.77
49 0.7
50 0.62
51 0.52
52 0.43
53 0.37
54 0.28
55 0.23
56 0.16
57 0.14
58 0.12
59 0.12
60 0.11
61 0.1
62 0.11
63 0.1
64 0.09
65 0.08
66 0.07
67 0.06
68 0.06
69 0.08
70 0.08
71 0.09
72 0.09
73 0.09
74 0.09
75 0.11
76 0.1
77 0.09
78 0.1
79 0.09
80 0.09
81 0.11
82 0.11
83 0.09
84 0.1
85 0.1
86 0.1
87 0.11
88 0.12
89 0.12
90 0.18
91 0.23
92 0.3
93 0.31
94 0.32
95 0.34
96 0.38
97 0.44
98 0.42
99 0.43
100 0.38
101 0.4
102 0.44
103 0.45
104 0.41
105 0.35
106 0.34
107 0.29
108 0.28
109 0.24
110 0.17
111 0.14
112 0.13
113 0.14
114 0.14
115 0.17
116 0.18
117 0.22