Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2MKF9

Protein Details
Accession A0A0D2MKF9   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
250-277SSTVETQAKRPRGRPKGSKNKNKASGDDHydrophilic
NLS Segment(s)
PositionSequence
258-272KRPRGRPKGSKNKNK
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR018482  Znf-C4H2  
Pfam View protein in Pfam  
PF10146  zf-C4H2  
Amino Acid Sequences MSQHIQHHHAQYVHYNPNPHPQQQLPVTHVAPKDTQHKLPEQASQPTQQKQQRSQQVASQSAQASASGSTPVVAKGDWTKDLVHLAKTAELKKHALTLQLHTAHILSAHASLEQKGKAIQDLREQKNKLESERTRLLNCLREVNEDRDKVDLMESSLEKECRDTRTKITQLTETDYAVAKADVDRLRKELGQPALPSLQHTLEEKTSQYLNERRLTGNESQSAALPGPSRSMSASAAPSSNKRPAPVPSSSTVETQAKRPRGRPKGSKNKNKASGDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.46
3 0.43
4 0.52
5 0.54
6 0.5
7 0.48
8 0.42
9 0.47
10 0.49
11 0.52
12 0.45
13 0.45
14 0.44
15 0.43
16 0.42
17 0.37
18 0.33
19 0.32
20 0.36
21 0.36
22 0.39
23 0.39
24 0.43
25 0.46
26 0.47
27 0.5
28 0.47
29 0.49
30 0.47
31 0.5
32 0.51
33 0.5
34 0.56
35 0.54
36 0.57
37 0.58
38 0.64
39 0.66
40 0.67
41 0.64
42 0.6
43 0.62
44 0.59
45 0.51
46 0.46
47 0.37
48 0.31
49 0.29
50 0.24
51 0.17
52 0.13
53 0.12
54 0.08
55 0.08
56 0.07
57 0.07
58 0.08
59 0.08
60 0.07
61 0.08
62 0.11
63 0.14
64 0.15
65 0.16
66 0.16
67 0.17
68 0.22
69 0.22
70 0.19
71 0.18
72 0.17
73 0.2
74 0.23
75 0.25
76 0.23
77 0.24
78 0.25
79 0.23
80 0.27
81 0.24
82 0.26
83 0.24
84 0.24
85 0.29
86 0.29
87 0.28
88 0.25
89 0.24
90 0.18
91 0.16
92 0.13
93 0.07
94 0.06
95 0.06
96 0.07
97 0.07
98 0.08
99 0.11
100 0.11
101 0.11
102 0.11
103 0.11
104 0.13
105 0.16
106 0.16
107 0.22
108 0.32
109 0.36
110 0.42
111 0.43
112 0.41
113 0.46
114 0.45
115 0.39
116 0.39
117 0.36
118 0.36
119 0.41
120 0.42
121 0.35
122 0.36
123 0.36
124 0.33
125 0.32
126 0.29
127 0.24
128 0.27
129 0.29
130 0.32
131 0.35
132 0.3
133 0.3
134 0.26
135 0.25
136 0.2
137 0.18
138 0.13
139 0.08
140 0.1
141 0.09
142 0.11
143 0.12
144 0.13
145 0.12
146 0.14
147 0.16
148 0.19
149 0.24
150 0.24
151 0.28
152 0.37
153 0.41
154 0.42
155 0.42
156 0.42
157 0.39
158 0.41
159 0.36
160 0.27
161 0.24
162 0.2
163 0.18
164 0.14
165 0.12
166 0.08
167 0.07
168 0.12
169 0.15
170 0.17
171 0.18
172 0.2
173 0.22
174 0.23
175 0.25
176 0.25
177 0.26
178 0.27
179 0.26
180 0.27
181 0.28
182 0.27
183 0.27
184 0.22
185 0.19
186 0.17
187 0.18
188 0.18
189 0.17
190 0.18
191 0.17
192 0.17
193 0.17
194 0.17
195 0.22
196 0.25
197 0.29
198 0.32
199 0.34
200 0.33
201 0.34
202 0.38
203 0.37
204 0.36
205 0.34
206 0.3
207 0.29
208 0.28
209 0.27
210 0.23
211 0.19
212 0.15
213 0.13
214 0.14
215 0.14
216 0.14
217 0.13
218 0.15
219 0.15
220 0.17
221 0.19
222 0.18
223 0.2
224 0.22
225 0.25
226 0.28
227 0.35
228 0.33
229 0.32
230 0.35
231 0.38
232 0.42
233 0.43
234 0.42
235 0.39
236 0.43
237 0.43
238 0.41
239 0.41
240 0.42
241 0.37
242 0.41
243 0.46
244 0.49
245 0.54
246 0.6
247 0.65
248 0.69
249 0.78
250 0.8
251 0.82
252 0.85
253 0.9
254 0.93
255 0.93
256 0.93
257 0.93