Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2N6T7

Protein Details
Accession A0A0D2N6T7    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-21RLVRKANKEKRKFHAYKERABasic
NLS Segment(s)
PositionSequence
5-26RKANKEKRKFHAYKERALKKLE
Subcellular Location(s) nucl 17, cyto 6, mito 4
Family & Domain DBs
Amino Acid Sequences MRLVRKANKEKRKFHAYKERALKKLERAIAKVDQADRRLHQTEICRGRLFDIIQASGFQIPAYVYLLLHFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.8
3 0.74
4 0.74
5 0.76
6 0.76
7 0.68
8 0.68
9 0.62
10 0.58
11 0.6
12 0.56
13 0.49
14 0.42
15 0.42
16 0.41
17 0.38
18 0.33
19 0.3
20 0.27
21 0.27
22 0.27
23 0.24
24 0.26
25 0.26
26 0.24
27 0.23
28 0.24
29 0.31
30 0.35
31 0.37
32 0.33
33 0.31
34 0.33
35 0.33
36 0.29
37 0.24
38 0.2
39 0.18
40 0.18
41 0.18
42 0.17
43 0.14
44 0.14
45 0.1
46 0.08
47 0.07
48 0.08
49 0.1
50 0.09
51 0.08