Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2PB74

Protein Details
Accession A0A0D2PB74    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
56-82INTIFGPKWKRLRKQRLKFWDPRLPLEHydrophilic
NLS Segment(s)
PositionSequence
65-69KRLRK
Subcellular Location(s) mito 13, nucl 9, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000409  BEACH_dom  
PROSITE View protein in PROSITE  
PS50197  BEACH  
Amino Acid Sequences MPPRRAPSVQSVAQSRAPSPSPGDAEEEVAFFDTVDELQQHGINVQDILKLKSAAINTIFGPKWKRLRKQRLKFWDPRLPLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.36
3 0.32
4 0.29
5 0.26
6 0.25
7 0.25
8 0.23
9 0.23
10 0.26
11 0.22
12 0.23
13 0.22
14 0.19
15 0.15
16 0.13
17 0.12
18 0.08
19 0.07
20 0.05
21 0.04
22 0.05
23 0.05
24 0.04
25 0.05
26 0.06
27 0.06
28 0.06
29 0.06
30 0.06
31 0.06
32 0.06
33 0.08
34 0.09
35 0.1
36 0.11
37 0.11
38 0.11
39 0.13
40 0.13
41 0.13
42 0.13
43 0.14
44 0.13
45 0.18
46 0.19
47 0.19
48 0.23
49 0.27
50 0.36
51 0.43
52 0.53
53 0.59
54 0.7
55 0.78
56 0.85
57 0.9
58 0.91
59 0.92
60 0.91
61 0.9
62 0.88