Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2NWP9

Protein Details
Accession A0A0D2NWP9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
76-96PPWRVRTYTGREKRHRYRNCGBasic
NLS Segment(s)
Subcellular Location(s) cyto 17.5, cyto_nucl 9.5, mito 4, extr 4
Family & Domain DBs
Amino Acid Sequences MECARGWCWGVLFGWVGVGGVVVEGDWREGVIGSELCLLCLSKVGNAGGWLGGCGRSREWSAFISTTVIQHDATRPPWRVRTYTGREKRHRYRNCGAIRNRGGIIIYKAAPPLRGSGLETRRVSDWMQSASVGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.09
4 0.07
5 0.06
6 0.04
7 0.03
8 0.03
9 0.03
10 0.03
11 0.03
12 0.04
13 0.04
14 0.04
15 0.04
16 0.04
17 0.05
18 0.07
19 0.07
20 0.07
21 0.12
22 0.12
23 0.12
24 0.12
25 0.12
26 0.09
27 0.11
28 0.11
29 0.07
30 0.09
31 0.09
32 0.09
33 0.09
34 0.1
35 0.08
36 0.08
37 0.07
38 0.05
39 0.07
40 0.08
41 0.08
42 0.09
43 0.1
44 0.12
45 0.12
46 0.14
47 0.13
48 0.14
49 0.14
50 0.14
51 0.13
52 0.12
53 0.12
54 0.11
55 0.11
56 0.09
57 0.09
58 0.11
59 0.11
60 0.14
61 0.18
62 0.21
63 0.23
64 0.28
65 0.31
66 0.31
67 0.34
68 0.41
69 0.44
70 0.52
71 0.59
72 0.63
73 0.68
74 0.75
75 0.8
76 0.81
77 0.8
78 0.78
79 0.76
80 0.76
81 0.77
82 0.77
83 0.72
84 0.72
85 0.67
86 0.62
87 0.54
88 0.45
89 0.37
90 0.31
91 0.28
92 0.21
93 0.19
94 0.17
95 0.19
96 0.19
97 0.2
98 0.18
99 0.18
100 0.17
101 0.18
102 0.2
103 0.27
104 0.31
105 0.38
106 0.38
107 0.38
108 0.37
109 0.38
110 0.35
111 0.32
112 0.32
113 0.26
114 0.26