Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2NV25

Protein Details
Accession A0A0D2NV25    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
35-61ASSYAAGRGRRRSRRSRARVRVRPCACHydrophilic
98-119EAQRRRAPRARLRRRGACRRSIBasic
NLS Segment(s)
PositionSequence
40-55AGRGRRRSRRSRARVR
98-121EAQRRRAPRARLRRRGACRRSIRG
Subcellular Location(s) mito 14, nucl 6.5, cyto_nucl 5.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MISAAARRPMLSAASLEPGHHAGGQRPAAAAMRAASSYAAGRGRRRSRRSRARVRVRPCACADGDCDQRRLARRRRCASGTRARTASCAARLGTPPPEAQRRRAPRARLRRRGACRRSIRGPGAASSVRAVRCGAVRANERRVFARSSPIFMSFLCEQFRRAKFVLHTAYATPVDWKKVRPRRVRRCA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.18
4 0.19
5 0.19
6 0.18
7 0.18
8 0.17
9 0.16
10 0.22
11 0.24
12 0.22
13 0.21
14 0.21
15 0.21
16 0.2
17 0.18
18 0.11
19 0.11
20 0.1
21 0.1
22 0.09
23 0.09
24 0.09
25 0.12
26 0.15
27 0.18
28 0.23
29 0.32
30 0.42
31 0.51
32 0.59
33 0.66
34 0.73
35 0.81
36 0.87
37 0.88
38 0.89
39 0.91
40 0.91
41 0.88
42 0.88
43 0.79
44 0.74
45 0.65
46 0.58
47 0.48
48 0.39
49 0.36
50 0.31
51 0.37
52 0.32
53 0.31
54 0.28
55 0.31
56 0.38
57 0.43
58 0.47
59 0.47
60 0.56
61 0.6
62 0.66
63 0.67
64 0.65
65 0.65
66 0.66
67 0.63
68 0.58
69 0.54
70 0.48
71 0.43
72 0.4
73 0.33
74 0.24
75 0.19
76 0.15
77 0.15
78 0.16
79 0.17
80 0.17
81 0.16
82 0.15
83 0.17
84 0.25
85 0.25
86 0.29
87 0.37
88 0.42
89 0.49
90 0.54
91 0.59
92 0.6
93 0.7
94 0.76
95 0.77
96 0.77
97 0.79
98 0.82
99 0.85
100 0.81
101 0.8
102 0.77
103 0.73
104 0.71
105 0.68
106 0.61
107 0.55
108 0.5
109 0.41
110 0.38
111 0.32
112 0.26
113 0.21
114 0.22
115 0.17
116 0.17
117 0.16
118 0.13
119 0.13
120 0.16
121 0.16
122 0.18
123 0.26
124 0.3
125 0.39
126 0.41
127 0.42
128 0.42
129 0.42
130 0.41
131 0.35
132 0.39
133 0.32
134 0.32
135 0.32
136 0.32
137 0.3
138 0.25
139 0.3
140 0.22
141 0.24
142 0.24
143 0.22
144 0.23
145 0.31
146 0.33
147 0.34
148 0.33
149 0.35
150 0.34
151 0.43
152 0.45
153 0.39
154 0.39
155 0.34
156 0.37
157 0.32
158 0.3
159 0.27
160 0.24
161 0.29
162 0.29
163 0.34
164 0.41
165 0.5
166 0.6
167 0.65
168 0.74