Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2LMR0

Protein Details
Accession A0A0D2LMR0    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
49-73LSEACGPRRDPRARRPRRQSRREAGBasic
NLS Segment(s)
PositionSequence
56-73RRDPRARRPRRQSRREAG
Subcellular Location(s) mito 14.5, cyto_mito 10.5, cyto 5.5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000860  HemC  
IPR022417  Porphobilin_deaminase_N  
Gene Ontology GO:0004418  F:hydroxymethylbilane synthase activity  
GO:0006783  P:heme biosynthetic process  
Pfam View protein in Pfam  
PF01379  Porphobil_deam  
Amino Acid Sequences MTTAGDKNQSQALYLIGGKALWTKELEVALKARHVDMLVHCLKDVPTTLSEACGPRRDPRARRPRRQSRREAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.14
3 0.1
4 0.09
5 0.08
6 0.11
7 0.1
8 0.09
9 0.09
10 0.1
11 0.12
12 0.14
13 0.14
14 0.12
15 0.14
16 0.13
17 0.14
18 0.14
19 0.12
20 0.11
21 0.1
22 0.1
23 0.09
24 0.15
25 0.15
26 0.15
27 0.15
28 0.15
29 0.14
30 0.14
31 0.14
32 0.1
33 0.09
34 0.12
35 0.12
36 0.13
37 0.15
38 0.17
39 0.19
40 0.22
41 0.23
42 0.26
43 0.36
44 0.44
45 0.49
46 0.58
47 0.66
48 0.73
49 0.81
50 0.87
51 0.89
52 0.91
53 0.94