Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2KN63

Protein Details
Accession A0A0D2KN63    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
139-165PVWLECLRRRPLRPRHPPRASPRCCLRHydrophilic
NLS Segment(s)
PositionSequence
148-154RPLRPRH
Subcellular Location(s) mito 11.5, cyto_mito 9, cyto 5.5, nucl 5, plas 3
Family & Domain DBs
Amino Acid Sequences MCPTRVACFSGAVRPLVSFTPTVLSPLCPTGLGITTPPKRSNHTSTSPSKTAAAARTLHSQFPYPLPTGVLLMRFVITRKRTTVGFLPMPHFPIIVPLPFAFPFSSNSLCTPVLRPSIFVHRAIDLSLIITPISSDCAPVWLECLRRRPLRPRHPPRASPRCCLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.21
4 0.2
5 0.14
6 0.12
7 0.14
8 0.14
9 0.15
10 0.14
11 0.14
12 0.14
13 0.15
14 0.15
15 0.12
16 0.12
17 0.12
18 0.13
19 0.12
20 0.13
21 0.2
22 0.25
23 0.29
24 0.33
25 0.33
26 0.38
27 0.44
28 0.49
29 0.47
30 0.49
31 0.52
32 0.55
33 0.6
34 0.56
35 0.51
36 0.45
37 0.39
38 0.36
39 0.31
40 0.27
41 0.21
42 0.22
43 0.28
44 0.28
45 0.28
46 0.25
47 0.24
48 0.22
49 0.22
50 0.23
51 0.16
52 0.15
53 0.14
54 0.14
55 0.13
56 0.13
57 0.12
58 0.09
59 0.08
60 0.08
61 0.08
62 0.08
63 0.13
64 0.14
65 0.15
66 0.17
67 0.18
68 0.18
69 0.2
70 0.23
71 0.22
72 0.23
73 0.23
74 0.23
75 0.23
76 0.24
77 0.22
78 0.18
79 0.13
80 0.13
81 0.12
82 0.11
83 0.11
84 0.09
85 0.11
86 0.11
87 0.13
88 0.1
89 0.1
90 0.12
91 0.14
92 0.16
93 0.15
94 0.16
95 0.18
96 0.19
97 0.18
98 0.18
99 0.19
100 0.22
101 0.21
102 0.22
103 0.21
104 0.3
105 0.31
106 0.3
107 0.28
108 0.24
109 0.25
110 0.23
111 0.21
112 0.12
113 0.1
114 0.09
115 0.08
116 0.07
117 0.06
118 0.06
119 0.05
120 0.09
121 0.08
122 0.09
123 0.09
124 0.11
125 0.12
126 0.12
127 0.14
128 0.15
129 0.21
130 0.25
131 0.32
132 0.38
133 0.45
134 0.53
135 0.6
136 0.68
137 0.73
138 0.79
139 0.83
140 0.86
141 0.88
142 0.91
143 0.92
144 0.92
145 0.86