Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9EB31

Protein Details
Accession E9EB31    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
99-124EDKARVLEKTKKRNTHFPQRKFAIKAHydrophilic
NLS Segment(s)
PositionSequence
89-119TRAIRRRLSPEDKARVLEKTKKRNTHFPQRK
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
KEGG maw:MAC_07079  -  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSSGKVKTVQLWDKSKDDLTKQLSELKTELGQLRIQKVASSGSKLNKIHDLRKSIARVLTVINAKQRSQLRLFYKNKKYAPLDLRVKQTRAIRRRLSPEDKARVLEKTKKRNTHFPQRKFAIKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.53
3 0.48
4 0.44
5 0.44
6 0.42
7 0.41
8 0.4
9 0.45
10 0.41
11 0.38
12 0.36
13 0.3
14 0.25
15 0.24
16 0.25
17 0.19
18 0.21
19 0.21
20 0.23
21 0.23
22 0.22
23 0.19
24 0.18
25 0.2
26 0.19
27 0.2
28 0.21
29 0.23
30 0.3
31 0.3
32 0.31
33 0.35
34 0.37
35 0.4
36 0.41
37 0.42
38 0.37
39 0.42
40 0.42
41 0.36
42 0.34
43 0.28
44 0.24
45 0.2
46 0.21
47 0.17
48 0.17
49 0.19
50 0.19
51 0.19
52 0.24
53 0.25
54 0.25
55 0.26
56 0.32
57 0.33
58 0.42
59 0.49
60 0.53
61 0.6
62 0.64
63 0.63
64 0.63
65 0.6
66 0.58
67 0.57
68 0.56
69 0.56
70 0.52
71 0.59
72 0.57
73 0.55
74 0.52
75 0.54
76 0.54
77 0.53
78 0.58
79 0.56
80 0.58
81 0.66
82 0.7
83 0.7
84 0.7
85 0.72
86 0.71
87 0.67
88 0.63
89 0.56
90 0.53
91 0.52
92 0.53
93 0.53
94 0.56
95 0.63
96 0.7
97 0.74
98 0.79
99 0.82
100 0.83
101 0.85
102 0.82
103 0.83
104 0.8