Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2NGE4

Protein Details
Accession A0A0D2NGE4   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
152-185PGTLRPQHRAHRRRPQRSAKVRRRHPTRVVPRLPBasic
NLS Segment(s)
PositionSequence
126-129RHRR
156-187RPQHRAHRRRPQRSAKVRRRHPTRVVPRLPAR
Subcellular Location(s) mito 8, nucl 6, plas 6, cyto 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSTTMQDASQIQRRHRPAEEVRALRRAGPAQLRVRVVRVRMELVRVLRMLRRRRPAVHLQRLLQHLALAPKLTPALLLLLLLVLLLVLVVIVAVAGVLFAVLFRRGGERRRRCHRCARAWQDERGRHRRRAEHHLPALRVLDALHPSTPTHPGTLRPQHRAHRRRPQRSAKVRRRHPTRVVPRLPARLARLAERADGHQVPAPHPTTACTRCRIGSGRDGRRGNGLGDCVVKERRVEHVVELDRLRVRVHGHGMCMGVLAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.56
3 0.58
4 0.58
5 0.64
6 0.68
7 0.66
8 0.65
9 0.65
10 0.62
11 0.55
12 0.51
13 0.43
14 0.4
15 0.39
16 0.42
17 0.43
18 0.49
19 0.5
20 0.47
21 0.5
22 0.47
23 0.43
24 0.4
25 0.37
26 0.36
27 0.33
28 0.35
29 0.34
30 0.32
31 0.33
32 0.28
33 0.27
34 0.27
35 0.34
36 0.4
37 0.44
38 0.52
39 0.55
40 0.58
41 0.64
42 0.7
43 0.73
44 0.74
45 0.72
46 0.65
47 0.65
48 0.63
49 0.57
50 0.46
51 0.35
52 0.27
53 0.23
54 0.21
55 0.15
56 0.13
57 0.12
58 0.12
59 0.11
60 0.08
61 0.07
62 0.07
63 0.06
64 0.06
65 0.05
66 0.05
67 0.05
68 0.04
69 0.04
70 0.02
71 0.02
72 0.01
73 0.01
74 0.01
75 0.01
76 0.01
77 0.01
78 0.01
79 0.01
80 0.01
81 0.01
82 0.01
83 0.01
84 0.01
85 0.01
86 0.01
87 0.02
88 0.03
89 0.03
90 0.04
91 0.08
92 0.11
93 0.19
94 0.29
95 0.38
96 0.47
97 0.58
98 0.65
99 0.67
100 0.75
101 0.78
102 0.77
103 0.79
104 0.79
105 0.79
106 0.75
107 0.76
108 0.74
109 0.7
110 0.69
111 0.69
112 0.65
113 0.61
114 0.63
115 0.63
116 0.6
117 0.64
118 0.63
119 0.6
120 0.62
121 0.59
122 0.54
123 0.49
124 0.44
125 0.34
126 0.26
127 0.18
128 0.13
129 0.1
130 0.11
131 0.09
132 0.09
133 0.1
134 0.11
135 0.14
136 0.13
137 0.13
138 0.13
139 0.16
140 0.24
141 0.33
142 0.37
143 0.39
144 0.45
145 0.52
146 0.62
147 0.67
148 0.69
149 0.71
150 0.76
151 0.8
152 0.85
153 0.87
154 0.87
155 0.9
156 0.92
157 0.91
158 0.91
159 0.9
160 0.9
161 0.88
162 0.86
163 0.84
164 0.83
165 0.83
166 0.84
167 0.79
168 0.77
169 0.74
170 0.71
171 0.65
172 0.58
173 0.51
174 0.46
175 0.43
176 0.38
177 0.36
178 0.31
179 0.31
180 0.28
181 0.26
182 0.25
183 0.24
184 0.22
185 0.2
186 0.2
187 0.19
188 0.24
189 0.24
190 0.19
191 0.19
192 0.2
193 0.26
194 0.31
195 0.34
196 0.32
197 0.32
198 0.32
199 0.37
200 0.4
201 0.36
202 0.39
203 0.46
204 0.51
205 0.57
206 0.58
207 0.54
208 0.55
209 0.53
210 0.45
211 0.37
212 0.3
213 0.24
214 0.24
215 0.24
216 0.22
217 0.23
218 0.23
219 0.22
220 0.22
221 0.26
222 0.28
223 0.28
224 0.28
225 0.34
226 0.36
227 0.4
228 0.39
229 0.37
230 0.36
231 0.36
232 0.33
233 0.27
234 0.26
235 0.27
236 0.34
237 0.32
238 0.32
239 0.34
240 0.34
241 0.31