Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2NIN9

Protein Details
Accession A0A0D2NIN9    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
53-79IPSVPLKKRLQQRLKKEKRRTKQLFGWHydrophilic
NLS Segment(s)
PositionSequence
59-73KKRLQQRLKKEKRRT
Subcellular Location(s) plas 12, extr 11, nucl 2, E.R. 2
Family & Domain DBs
Amino Acid Sequences MRPDTMSILFLFLVSLVSAAPITTGNESHLDTVFSNGIISGSSPYTTRFSTQIPSVPLKKRLQQRLKKEKRRTKQLFGWMWSYIEAAQERERDDIYLLRALEDPVFLAAYSSGSSTTSAQRVTGDEKLDGVLSRRASAELTVRDIVELANSVPQSRTPKIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.04
4 0.05
5 0.05
6 0.04
7 0.05
8 0.05
9 0.07
10 0.08
11 0.09
12 0.1
13 0.12
14 0.13
15 0.14
16 0.14
17 0.14
18 0.13
19 0.15
20 0.13
21 0.11
22 0.1
23 0.09
24 0.08
25 0.07
26 0.07
27 0.06
28 0.06
29 0.07
30 0.08
31 0.1
32 0.12
33 0.13
34 0.15
35 0.15
36 0.16
37 0.18
38 0.2
39 0.22
40 0.23
41 0.27
42 0.32
43 0.34
44 0.4
45 0.41
46 0.45
47 0.5
48 0.57
49 0.63
50 0.65
51 0.72
52 0.76
53 0.84
54 0.88
55 0.9
56 0.89
57 0.88
58 0.91
59 0.87
60 0.83
61 0.79
62 0.78
63 0.72
64 0.64
65 0.58
66 0.47
67 0.4
68 0.32
69 0.25
70 0.15
71 0.12
72 0.1
73 0.09
74 0.11
75 0.12
76 0.13
77 0.13
78 0.13
79 0.12
80 0.12
81 0.12
82 0.12
83 0.13
84 0.12
85 0.12
86 0.13
87 0.13
88 0.12
89 0.1
90 0.09
91 0.06
92 0.06
93 0.05
94 0.05
95 0.04
96 0.05
97 0.05
98 0.05
99 0.05
100 0.06
101 0.07
102 0.08
103 0.11
104 0.13
105 0.13
106 0.13
107 0.14
108 0.16
109 0.19
110 0.21
111 0.2
112 0.18
113 0.18
114 0.18
115 0.18
116 0.16
117 0.15
118 0.16
119 0.15
120 0.16
121 0.16
122 0.16
123 0.16
124 0.18
125 0.22
126 0.2
127 0.23
128 0.23
129 0.23
130 0.22
131 0.22
132 0.19
133 0.14
134 0.12
135 0.08
136 0.11
137 0.11
138 0.13
139 0.13
140 0.19
141 0.25