Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2P030

Protein Details
Accession A0A0D2P030    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
228-253QPMNVDRSSRKKRAERVFWNKTKTRPHydrophilic
NLS Segment(s)
PositionSequence
239-239K
Subcellular Location(s) nucl 14, cyto_nucl 10.5, cyto 5, pero 5
Family & Domain DBs
Amino Acid Sequences MTADQDSKTVTRLAQDRRYRELLEQRTNIDLTLRVLAYTILAENEYIPNIEEFLDLPCNSVINALAGLAPIVVCGTNKTIHFVDDAFPDFLLDETRSAKFYIDWGVWHAKFSHHYFERMKTGAYGTHELSLITFHLQNINSSQQLHEDILSFAYTLDQLSYLSHAYEGLWDEVSDFLTAVKGLKFDDNDEAYSLQRDRMASLLARDFKAFRGQLISLVANHNIHLRVQPMNVDRSSRKKRAERVFWNKTKTRPMPKTVMPSGPCGMLIQRRGKYLQERARQHHN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.52
3 0.55
4 0.6
5 0.64
6 0.6
7 0.6
8 0.61
9 0.61
10 0.61
11 0.59
12 0.54
13 0.53
14 0.51
15 0.43
16 0.35
17 0.27
18 0.2
19 0.2
20 0.18
21 0.14
22 0.14
23 0.14
24 0.13
25 0.12
26 0.1
27 0.07
28 0.07
29 0.07
30 0.08
31 0.09
32 0.09
33 0.09
34 0.09
35 0.08
36 0.09
37 0.09
38 0.08
39 0.08
40 0.09
41 0.14
42 0.13
43 0.14
44 0.14
45 0.13
46 0.13
47 0.13
48 0.11
49 0.07
50 0.07
51 0.06
52 0.06
53 0.05
54 0.05
55 0.05
56 0.04
57 0.03
58 0.04
59 0.04
60 0.04
61 0.05
62 0.07
63 0.1
64 0.11
65 0.15
66 0.15
67 0.15
68 0.16
69 0.16
70 0.16
71 0.15
72 0.18
73 0.14
74 0.13
75 0.13
76 0.12
77 0.11
78 0.11
79 0.09
80 0.08
81 0.1
82 0.11
83 0.12
84 0.12
85 0.12
86 0.11
87 0.12
88 0.14
89 0.12
90 0.11
91 0.14
92 0.2
93 0.19
94 0.2
95 0.19
96 0.18
97 0.21
98 0.23
99 0.28
100 0.23
101 0.29
102 0.3
103 0.33
104 0.36
105 0.32
106 0.3
107 0.22
108 0.21
109 0.19
110 0.19
111 0.18
112 0.15
113 0.15
114 0.15
115 0.14
116 0.13
117 0.11
118 0.08
119 0.07
120 0.07
121 0.06
122 0.09
123 0.09
124 0.1
125 0.11
126 0.13
127 0.12
128 0.12
129 0.12
130 0.11
131 0.12
132 0.12
133 0.1
134 0.09
135 0.08
136 0.08
137 0.08
138 0.07
139 0.05
140 0.05
141 0.05
142 0.04
143 0.04
144 0.04
145 0.04
146 0.04
147 0.05
148 0.05
149 0.05
150 0.05
151 0.05
152 0.05
153 0.06
154 0.07
155 0.07
156 0.07
157 0.07
158 0.07
159 0.07
160 0.08
161 0.07
162 0.05
163 0.05
164 0.05
165 0.05
166 0.06
167 0.06
168 0.06
169 0.07
170 0.09
171 0.1
172 0.11
173 0.16
174 0.17
175 0.17
176 0.18
177 0.17
178 0.15
179 0.17
180 0.16
181 0.12
182 0.13
183 0.13
184 0.12
185 0.12
186 0.14
187 0.12
188 0.14
189 0.19
190 0.2
191 0.21
192 0.21
193 0.21
194 0.2
195 0.27
196 0.24
197 0.19
198 0.2
199 0.2
200 0.21
201 0.23
202 0.23
203 0.17
204 0.19
205 0.2
206 0.16
207 0.16
208 0.17
209 0.15
210 0.15
211 0.15
212 0.15
213 0.15
214 0.16
215 0.21
216 0.22
217 0.27
218 0.27
219 0.31
220 0.33
221 0.42
222 0.5
223 0.53
224 0.58
225 0.61
226 0.7
227 0.76
228 0.81
229 0.82
230 0.84
231 0.87
232 0.85
233 0.86
234 0.82
235 0.77
236 0.78
237 0.76
238 0.76
239 0.73
240 0.73
241 0.72
242 0.73
243 0.76
244 0.71
245 0.7
246 0.6
247 0.57
248 0.52
249 0.44
250 0.38
251 0.3
252 0.28
253 0.27
254 0.32
255 0.36
256 0.37
257 0.4
258 0.42
259 0.48
260 0.52
261 0.56
262 0.59
263 0.6
264 0.66