Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2KNX9

Protein Details
Accession A0A0D2KNX9    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
120-162TSTPRSSGPRRRKTKASYTNPDQPRKCPKIKKNKENRTIFTPSHydrophilic
NLS Segment(s)
PositionSequence
127-134GPRRRKTK
Subcellular Location(s) nucl 19, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
Amino Acid Sequences MLSNLEQALIDTIKAKRDPTYQNVLSIYCDTPGIASGFPDHDPAVYFHHSLDKYADAEDKVDSPFAKYIRVIRAQYWGIVIDLAEVVLGTENLPCPCKCGKWDTSDGIRRQLGVISDDKTSTPRSSGPRRRKTKASYTNPDQPRKCPKIKKNKENRTIFTPSGSRISVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.25
4 0.32
5 0.38
6 0.41
7 0.49
8 0.45
9 0.47
10 0.47
11 0.43
12 0.38
13 0.34
14 0.28
15 0.19
16 0.17
17 0.13
18 0.12
19 0.13
20 0.11
21 0.08
22 0.08
23 0.09
24 0.11
25 0.12
26 0.13
27 0.11
28 0.1
29 0.11
30 0.12
31 0.16
32 0.16
33 0.16
34 0.15
35 0.22
36 0.22
37 0.21
38 0.22
39 0.19
40 0.17
41 0.17
42 0.19
43 0.13
44 0.13
45 0.13
46 0.12
47 0.11
48 0.12
49 0.11
50 0.1
51 0.13
52 0.13
53 0.13
54 0.13
55 0.17
56 0.21
57 0.26
58 0.26
59 0.24
60 0.28
61 0.27
62 0.26
63 0.23
64 0.18
65 0.12
66 0.11
67 0.1
68 0.05
69 0.04
70 0.04
71 0.03
72 0.02
73 0.02
74 0.02
75 0.02
76 0.02
77 0.03
78 0.04
79 0.05
80 0.07
81 0.07
82 0.11
83 0.12
84 0.14
85 0.15
86 0.21
87 0.25
88 0.28
89 0.33
90 0.35
91 0.41
92 0.47
93 0.47
94 0.45
95 0.42
96 0.36
97 0.32
98 0.29
99 0.22
100 0.17
101 0.18
102 0.14
103 0.15
104 0.15
105 0.15
106 0.15
107 0.17
108 0.16
109 0.15
110 0.19
111 0.26
112 0.37
113 0.47
114 0.56
115 0.64
116 0.71
117 0.76
118 0.8
119 0.8
120 0.8
121 0.81
122 0.8
123 0.79
124 0.78
125 0.82
126 0.82
127 0.84
128 0.75
129 0.72
130 0.73
131 0.72
132 0.74
133 0.74
134 0.76
135 0.78
136 0.87
137 0.9
138 0.9
139 0.92
140 0.93
141 0.92
142 0.87
143 0.84
144 0.8
145 0.7
146 0.65
147 0.57
148 0.5
149 0.45