Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2PL63

Protein Details
Accession A0A0D2PL63   
Localization Confidence Low
Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
54-73TWESIPKKFRPLPRRKNIVIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 13, cyto_nucl 9.833, cyto_mito 8.833, nucl 5.5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012259  DHFR  
IPR024072  DHFR-like_dom_sf  
IPR017925  DHFR_CS  
IPR001796  DHFR_dom  
Gene Ontology GO:0004146  F:dihydrofolate reductase activity  
GO:0050661  F:NADP binding  
GO:0006545  P:glycine biosynthetic process  
GO:0006730  P:one-carbon metabolic process  
GO:0046654  P:tetrahydrofolate biosynthetic process  
Pfam View protein in Pfam  
PF00186  DHFR_1  
PROSITE View protein in PROSITE  
PS00075  DHFR_1  
PS51330  DHFR_2  
CDD cd00209  DHFR  
Amino Acid Sequences MSPLTIIVAATKANGIGINGGLPWKLSKELKYFAQATTNAPEGHQNAVIMGRNTWESIPKKFRPLPRRKNIVISTNPHYNLDTISTSAVLAHNLKSALELSHAQTPNLNREFIIGGATLYTEAIKLPPSPTEPYVDRVLLTRILAPDFKECDVSMSDFLQEEIDGKKVWARASHKELEEWVGFGVAEGELEENGVTYEFQMWLRGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.08
4 0.08
5 0.08
6 0.08
7 0.08
8 0.08
9 0.08
10 0.09
11 0.1
12 0.15
13 0.18
14 0.23
15 0.28
16 0.33
17 0.35
18 0.4
19 0.4
20 0.36
21 0.39
22 0.34
23 0.32
24 0.31
25 0.31
26 0.25
27 0.23
28 0.26
29 0.22
30 0.23
31 0.2
32 0.17
33 0.14
34 0.16
35 0.18
36 0.15
37 0.13
38 0.12
39 0.12
40 0.13
41 0.13
42 0.18
43 0.18
44 0.25
45 0.34
46 0.35
47 0.43
48 0.48
49 0.57
50 0.61
51 0.69
52 0.73
53 0.74
54 0.8
55 0.74
56 0.77
57 0.73
58 0.7
59 0.64
60 0.58
61 0.53
62 0.5
63 0.49
64 0.41
65 0.37
66 0.29
67 0.23
68 0.2
69 0.16
70 0.1
71 0.1
72 0.09
73 0.08
74 0.08
75 0.08
76 0.07
77 0.07
78 0.07
79 0.08
80 0.08
81 0.08
82 0.08
83 0.08
84 0.07
85 0.08
86 0.09
87 0.09
88 0.16
89 0.16
90 0.16
91 0.17
92 0.18
93 0.24
94 0.24
95 0.22
96 0.15
97 0.16
98 0.17
99 0.15
100 0.14
101 0.07
102 0.06
103 0.06
104 0.06
105 0.05
106 0.04
107 0.04
108 0.03
109 0.03
110 0.04
111 0.05
112 0.06
113 0.07
114 0.08
115 0.12
116 0.15
117 0.16
118 0.19
119 0.2
120 0.22
121 0.24
122 0.23
123 0.2
124 0.18
125 0.19
126 0.16
127 0.15
128 0.13
129 0.12
130 0.13
131 0.14
132 0.14
133 0.17
134 0.18
135 0.18
136 0.17
137 0.16
138 0.17
139 0.18
140 0.18
141 0.16
142 0.14
143 0.14
144 0.13
145 0.13
146 0.11
147 0.1
148 0.09
149 0.09
150 0.1
151 0.09
152 0.09
153 0.12
154 0.14
155 0.16
156 0.22
157 0.27
158 0.34
159 0.41
160 0.47
161 0.45
162 0.44
163 0.44
164 0.42
165 0.37
166 0.29
167 0.22
168 0.15
169 0.14
170 0.12
171 0.12
172 0.06
173 0.06
174 0.05
175 0.06
176 0.05
177 0.06
178 0.05
179 0.05
180 0.05
181 0.06
182 0.05
183 0.06
184 0.07
185 0.09
186 0.09