Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2L0T9

Protein Details
Accession A0A0D2L0T9   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
125-146GMSPMAKQKRKKGKKSAVPAGPHydrophilic
NLS Segment(s)
PositionSequence
130-141AKQKRKKGKKSA
165-165K
Subcellular Location(s) mito 10, nucl 9.5, cyto_nucl 9, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MAANPLTSPTLSSSFSEYDLVSNRSRSGSMVSEQLLPSNLDDSDDEIVWDISAESSASDSEFVLLSHRTSAVPSQTGRSTPNAGAQSPHTPIAARSLEEQMEALTLVAKGTPEQDKKASAQPGAGMSPMAKQKRKKGKKSAVPAGPTASGSVSTSPAPTSKSLKKAKHGKANAVVKYTGLGARPIVDDFSDQQSIVSYDNESVYSPTLYEEAASFISSFLSNPDAKSSSVYRLTLMQSIIIELGLATASLPSSLKSAKAFLKSRVFLNIREYIAVREQGPEAVQRAMYPSKTALIKGIRKNPTPIKWVKKHGLQVLLVGWMQH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.24
4 0.2
5 0.21
6 0.23
7 0.26
8 0.24
9 0.25
10 0.25
11 0.25
12 0.25
13 0.23
14 0.22
15 0.22
16 0.22
17 0.24
18 0.24
19 0.26
20 0.26
21 0.26
22 0.23
23 0.2
24 0.18
25 0.16
26 0.14
27 0.12
28 0.12
29 0.13
30 0.14
31 0.13
32 0.13
33 0.12
34 0.12
35 0.1
36 0.1
37 0.07
38 0.05
39 0.06
40 0.05
41 0.05
42 0.05
43 0.06
44 0.06
45 0.06
46 0.06
47 0.07
48 0.07
49 0.07
50 0.08
51 0.09
52 0.09
53 0.1
54 0.11
55 0.1
56 0.11
57 0.15
58 0.16
59 0.19
60 0.19
61 0.22
62 0.23
63 0.25
64 0.26
65 0.26
66 0.26
67 0.23
68 0.29
69 0.27
70 0.26
71 0.26
72 0.26
73 0.27
74 0.26
75 0.25
76 0.19
77 0.17
78 0.17
79 0.22
80 0.21
81 0.17
82 0.17
83 0.19
84 0.19
85 0.19
86 0.18
87 0.11
88 0.1
89 0.09
90 0.07
91 0.05
92 0.05
93 0.05
94 0.05
95 0.05
96 0.05
97 0.08
98 0.15
99 0.16
100 0.19
101 0.21
102 0.23
103 0.25
104 0.31
105 0.32
106 0.25
107 0.24
108 0.22
109 0.22
110 0.2
111 0.18
112 0.12
113 0.09
114 0.12
115 0.17
116 0.21
117 0.25
118 0.29
119 0.39
120 0.5
121 0.6
122 0.67
123 0.72
124 0.77
125 0.8
126 0.85
127 0.85
128 0.8
129 0.72
130 0.63
131 0.54
132 0.44
133 0.35
134 0.26
135 0.17
136 0.11
137 0.09
138 0.08
139 0.08
140 0.07
141 0.07
142 0.07
143 0.08
144 0.09
145 0.11
146 0.16
147 0.19
148 0.28
149 0.36
150 0.39
151 0.47
152 0.55
153 0.61
154 0.65
155 0.63
156 0.6
157 0.61
158 0.65
159 0.58
160 0.5
161 0.43
162 0.33
163 0.3
164 0.25
165 0.18
166 0.11
167 0.1
168 0.07
169 0.08
170 0.09
171 0.09
172 0.08
173 0.07
174 0.08
175 0.09
176 0.12
177 0.12
178 0.11
179 0.11
180 0.11
181 0.12
182 0.11
183 0.1
184 0.07
185 0.08
186 0.08
187 0.09
188 0.08
189 0.08
190 0.08
191 0.08
192 0.07
193 0.07
194 0.07
195 0.07
196 0.07
197 0.06
198 0.07
199 0.07
200 0.07
201 0.07
202 0.06
203 0.07
204 0.07
205 0.07
206 0.06
207 0.1
208 0.1
209 0.1
210 0.13
211 0.14
212 0.15
213 0.17
214 0.19
215 0.2
216 0.23
217 0.23
218 0.21
219 0.22
220 0.24
221 0.24
222 0.22
223 0.17
224 0.14
225 0.14
226 0.13
227 0.1
228 0.08
229 0.05
230 0.05
231 0.04
232 0.03
233 0.03
234 0.03
235 0.03
236 0.04
237 0.04
238 0.05
239 0.07
240 0.08
241 0.1
242 0.12
243 0.16
244 0.2
245 0.29
246 0.32
247 0.37
248 0.45
249 0.45
250 0.45
251 0.5
252 0.47
253 0.42
254 0.44
255 0.43
256 0.35
257 0.35
258 0.34
259 0.28
260 0.29
261 0.29
262 0.24
263 0.2
264 0.2
265 0.19
266 0.19
267 0.19
268 0.17
269 0.17
270 0.16
271 0.14
272 0.19
273 0.22
274 0.21
275 0.21
276 0.2
277 0.23
278 0.25
279 0.25
280 0.27
281 0.32
282 0.4
283 0.46
284 0.55
285 0.57
286 0.59
287 0.67
288 0.7
289 0.68
290 0.68
291 0.69
292 0.7
293 0.72
294 0.77
295 0.77
296 0.76
297 0.77
298 0.75
299 0.73
300 0.63
301 0.57
302 0.49
303 0.43