Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2NLE7

Protein Details
Accession A0A0D2NLE7    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
168-193PSLSHSTKPSPSKRKRSRSATTPSPSHydrophilic
NLS Segment(s)
PositionSequence
177-188SPSKRKRSRSAT
197-209PKYNARRSAAKRP
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MPTSPRSRSDSEEITPPPPIKGIILPRSDVALHFPQYCNTRYQVPLSQSPTVRIYVFFRPDLWWETLAPLVNGLYSLFTDHSLRNNIVWLTIPWTLYDVEQKAWVGIPTFTHIQVRSNEFLMIRVKSTLDIPLEEFGRMNNLISQLHDEYKSTLIKAANGMGMPVTPPSLSHSTKPSPSKRKRSRSATTPSPSSSSPKYNARRSAAKRPRLTASMRTPPSASVAQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.45
3 0.39
4 0.33
5 0.28
6 0.26
7 0.21
8 0.24
9 0.31
10 0.33
11 0.35
12 0.36
13 0.35
14 0.36
15 0.34
16 0.28
17 0.25
18 0.23
19 0.23
20 0.24
21 0.25
22 0.27
23 0.3
24 0.32
25 0.29
26 0.26
27 0.28
28 0.27
29 0.32
30 0.34
31 0.35
32 0.4
33 0.42
34 0.45
35 0.41
36 0.42
37 0.39
38 0.35
39 0.3
40 0.25
41 0.24
42 0.25
43 0.28
44 0.25
45 0.24
46 0.24
47 0.26
48 0.29
49 0.27
50 0.21
51 0.18
52 0.18
53 0.19
54 0.18
55 0.15
56 0.11
57 0.09
58 0.08
59 0.07
60 0.06
61 0.05
62 0.04
63 0.06
64 0.06
65 0.07
66 0.09
67 0.1
68 0.13
69 0.15
70 0.16
71 0.15
72 0.17
73 0.15
74 0.14
75 0.14
76 0.11
77 0.12
78 0.12
79 0.12
80 0.1
81 0.12
82 0.12
83 0.11
84 0.15
85 0.12
86 0.11
87 0.12
88 0.11
89 0.1
90 0.1
91 0.1
92 0.07
93 0.07
94 0.07
95 0.08
96 0.09
97 0.1
98 0.11
99 0.11
100 0.14
101 0.16
102 0.19
103 0.17
104 0.17
105 0.18
106 0.16
107 0.18
108 0.17
109 0.15
110 0.12
111 0.12
112 0.11
113 0.11
114 0.11
115 0.12
116 0.1
117 0.1
118 0.11
119 0.12
120 0.12
121 0.12
122 0.11
123 0.08
124 0.1
125 0.1
126 0.09
127 0.09
128 0.1
129 0.1
130 0.1
131 0.14
132 0.13
133 0.15
134 0.15
135 0.14
136 0.14
137 0.17
138 0.18
139 0.14
140 0.16
141 0.15
142 0.16
143 0.16
144 0.16
145 0.14
146 0.13
147 0.13
148 0.09
149 0.08
150 0.08
151 0.07
152 0.06
153 0.05
154 0.05
155 0.11
156 0.17
157 0.19
158 0.21
159 0.27
160 0.31
161 0.38
162 0.47
163 0.52
164 0.57
165 0.66
166 0.75
167 0.79
168 0.85
169 0.88
170 0.89
171 0.88
172 0.86
173 0.85
174 0.84
175 0.79
176 0.74
177 0.66
178 0.6
179 0.53
180 0.49
181 0.45
182 0.41
183 0.4
184 0.45
185 0.51
186 0.57
187 0.63
188 0.64
189 0.69
190 0.7
191 0.76
192 0.76
193 0.78
194 0.75
195 0.72
196 0.72
197 0.68
198 0.66
199 0.64
200 0.63
201 0.64
202 0.6
203 0.58
204 0.52
205 0.47
206 0.47