Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2KWR2

Protein Details
Accession A0A0D2KWR2   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
111-135DGRPLAAGKRHKKHRCVNWYPRGYYHydrophilic
NLS Segment(s)
PositionSequence
119-123KRHKK
Subcellular Location(s) mito 17, nucl 7, cyto_nucl 5.5
Family & Domain DBs
Amino Acid Sequences LRVTSHYTSLTELTGHQQRKLSRLLKLPTRAISQQRTHPSHRRSSRCSGLVMPLHPNIPSQTRPTPNSVETKSDSGSAATSTGAHATSAHPTRSTALRRSFVMDAPRSSADGRPLAAGKRHKKHRCVNWYPRGYYVDGKVDSSAARIGDGGTRRGPWVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.29
4 0.33
5 0.35
6 0.38
7 0.46
8 0.44
9 0.42
10 0.48
11 0.52
12 0.55
13 0.59
14 0.6
15 0.55
16 0.55
17 0.55
18 0.54
19 0.55
20 0.51
21 0.53
22 0.58
23 0.59
24 0.62
25 0.65
26 0.64
27 0.67
28 0.72
29 0.71
30 0.68
31 0.71
32 0.71
33 0.63
34 0.59
35 0.51
36 0.48
37 0.43
38 0.38
39 0.33
40 0.26
41 0.25
42 0.23
43 0.22
44 0.17
45 0.17
46 0.18
47 0.19
48 0.25
49 0.29
50 0.31
51 0.35
52 0.36
53 0.35
54 0.39
55 0.36
56 0.33
57 0.3
58 0.3
59 0.26
60 0.24
61 0.21
62 0.15
63 0.14
64 0.1
65 0.08
66 0.06
67 0.06
68 0.05
69 0.06
70 0.05
71 0.05
72 0.05
73 0.06
74 0.11
75 0.13
76 0.13
77 0.13
78 0.14
79 0.16
80 0.21
81 0.24
82 0.26
83 0.29
84 0.3
85 0.31
86 0.34
87 0.34
88 0.31
89 0.34
90 0.3
91 0.25
92 0.27
93 0.26
94 0.24
95 0.24
96 0.23
97 0.2
98 0.18
99 0.18
100 0.16
101 0.17
102 0.18
103 0.24
104 0.31
105 0.37
106 0.45
107 0.56
108 0.62
109 0.7
110 0.77
111 0.82
112 0.83
113 0.85
114 0.86
115 0.86
116 0.86
117 0.78
118 0.73
119 0.66
120 0.58
121 0.51
122 0.44
123 0.41
124 0.34
125 0.33
126 0.29
127 0.27
128 0.24
129 0.22
130 0.2
131 0.12
132 0.12
133 0.11
134 0.11
135 0.15
136 0.18
137 0.2
138 0.2
139 0.21