Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2NY65

Protein Details
Accession A0A0D2NY65    Localization Confidence High Confidence Score 16.6
NoLS Segment(s)
PositionSequenceProtein Nature
74-102GSGWLRTRSRRARCWRKPRPRHPLTSPRAHydrophilic
147-172TPSPTPRRASRPKYHAKSKPHPPIHLHydrophilic
NLS Segment(s)
PositionSequence
79-96RTRSRRARCWRKPRPRHP
152-168PRRASRPKYHAKSKPHP
Subcellular Location(s) nucl 16, cyto_nucl 10, mito 9
Family & Domain DBs
Amino Acid Sequences MHAYGPSPHTSHTATHTPHNPPHTRHARILTRYYAQYSSGPARMPAILSQILPPAEIPCALTADRIGAMPRPSGSGWLRTRSRRARCWRKPRPRHPLTSPRALSSAPRGPTLLYPLGGYIVPGWSRFHAPSSQNRRANRARVTNPITPSPTPRRASRPKYHAKSKPHPPIHLSKSAHLAHKHTIITSAPAPSAAAADIRRRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.39
3 0.45
4 0.47
5 0.51
6 0.58
7 0.58
8 0.55
9 0.63
10 0.64
11 0.63
12 0.62
13 0.65
14 0.65
15 0.64
16 0.66
17 0.6
18 0.55
19 0.52
20 0.5
21 0.42
22 0.35
23 0.3
24 0.29
25 0.28
26 0.26
27 0.24
28 0.21
29 0.22
30 0.2
31 0.2
32 0.16
33 0.16
34 0.14
35 0.14
36 0.15
37 0.16
38 0.15
39 0.14
40 0.14
41 0.11
42 0.1
43 0.1
44 0.1
45 0.07
46 0.09
47 0.09
48 0.09
49 0.08
50 0.08
51 0.09
52 0.08
53 0.08
54 0.09
55 0.1
56 0.11
57 0.11
58 0.12
59 0.12
60 0.16
61 0.17
62 0.23
63 0.25
64 0.31
65 0.35
66 0.37
67 0.46
68 0.5
69 0.56
70 0.58
71 0.66
72 0.7
73 0.76
74 0.84
75 0.86
76 0.88
77 0.92
78 0.93
79 0.93
80 0.88
81 0.85
82 0.83
83 0.82
84 0.76
85 0.74
86 0.65
87 0.55
88 0.49
89 0.42
90 0.34
91 0.29
92 0.29
93 0.21
94 0.2
95 0.19
96 0.19
97 0.19
98 0.22
99 0.17
100 0.12
101 0.11
102 0.1
103 0.11
104 0.1
105 0.09
106 0.06
107 0.06
108 0.06
109 0.07
110 0.08
111 0.08
112 0.11
113 0.11
114 0.13
115 0.17
116 0.2
117 0.3
118 0.39
119 0.47
120 0.52
121 0.53
122 0.58
123 0.6
124 0.63
125 0.61
126 0.6
127 0.54
128 0.57
129 0.61
130 0.59
131 0.56
132 0.52
133 0.49
134 0.42
135 0.46
136 0.45
137 0.47
138 0.46
139 0.47
140 0.53
141 0.59
142 0.67
143 0.7
144 0.71
145 0.74
146 0.79
147 0.85
148 0.84
149 0.83
150 0.84
151 0.84
152 0.85
153 0.81
154 0.77
155 0.73
156 0.74
157 0.71
158 0.71
159 0.63
160 0.55
161 0.56
162 0.55
163 0.56
164 0.49
165 0.46
166 0.42
167 0.44
168 0.42
169 0.35
170 0.33
171 0.28
172 0.28
173 0.27
174 0.24
175 0.19
176 0.18
177 0.18
178 0.15
179 0.15
180 0.11
181 0.12
182 0.13