Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2NK87

Protein Details
Accession A0A0D2NK87    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
53-72SSLPRSRRRSRPSPAPRLPFHydrophilic
NLS Segment(s)
PositionSequence
56-65PRSRRRSRPS
Subcellular Location(s) mito 22, nucl 3
Family & Domain DBs
Amino Acid Sequences MPRVQLTARVQLFACLRPRPRPPHTACSLPPRSLHSSLLVLVHASPSLPRPPSSLPRSRRRSRPSPAPRLPFPVLAPFLPCSPFTSRPSSCARDVEIQVAPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.36
4 0.42
5 0.5
6 0.55
7 0.58
8 0.64
9 0.65
10 0.67
11 0.67
12 0.66
13 0.61
14 0.63
15 0.61
16 0.53
17 0.48
18 0.44
19 0.46
20 0.41
21 0.38
22 0.3
23 0.26
24 0.25
25 0.24
26 0.18
27 0.12
28 0.1
29 0.09
30 0.06
31 0.05
32 0.05
33 0.06
34 0.1
35 0.11
36 0.11
37 0.13
38 0.17
39 0.25
40 0.31
41 0.38
42 0.42
43 0.51
44 0.6
45 0.64
46 0.71
47 0.71
48 0.74
49 0.73
50 0.77
51 0.77
52 0.79
53 0.8
54 0.77
55 0.71
56 0.69
57 0.64
58 0.54
59 0.45
60 0.4
61 0.34
62 0.28
63 0.27
64 0.21
65 0.21
66 0.2
67 0.19
68 0.18
69 0.22
70 0.28
71 0.29
72 0.37
73 0.36
74 0.39
75 0.46
76 0.47
77 0.45
78 0.42
79 0.43
80 0.42
81 0.42
82 0.42