Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2P5V4

Protein Details
Accession A0A0D2P5V4    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
34-56QATKSLTVPKPRRRVPKVQQAGPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 5, cyto 5, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001848  Ribosomal_S10  
IPR027486  Ribosomal_S10_dom  
IPR036838  Ribosomal_S10_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00338  Ribosomal_S10  
Amino Acid Sequences MSLRRFRLERRPRCSPPDAATTSTPAPTPTPEAQATKSLTVPKPRRRVPKVQQAGPILEGRGLKYDPATLPLTQTLDPNLAPFTEEDYAMTLIHRRSVGKPFFHPRTHDIPVVNIHIRSHHVCLLNLFTHFVTHAAAALPGLPVSQVANLPTQRRLWTXLHGPFAHKKTQENFERRVHKRAIKAWDADPEVVQRWVAYLRTHAMPGVSMGVVTWERMPLHVGAALKKEAVVKPSDQIASLGKKIVKDSVMPSSEHAPMCRLINEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.74
3 0.69
4 0.68
5 0.63
6 0.57
7 0.51
8 0.48
9 0.43
10 0.37
11 0.32
12 0.24
13 0.22
14 0.2
15 0.25
16 0.23
17 0.27
18 0.29
19 0.32
20 0.32
21 0.36
22 0.37
23 0.32
24 0.32
25 0.35
26 0.36
27 0.44
28 0.51
29 0.55
30 0.63
31 0.69
32 0.77
33 0.77
34 0.83
35 0.83
36 0.84
37 0.84
38 0.8
39 0.78
40 0.71
41 0.65
42 0.56
43 0.48
44 0.37
45 0.3
46 0.25
47 0.18
48 0.18
49 0.16
50 0.14
51 0.13
52 0.16
53 0.14
54 0.17
55 0.19
56 0.16
57 0.17
58 0.19
59 0.21
60 0.18
61 0.18
62 0.16
63 0.15
64 0.14
65 0.14
66 0.12
67 0.09
68 0.09
69 0.09
70 0.11
71 0.1
72 0.1
73 0.1
74 0.11
75 0.12
76 0.11
77 0.11
78 0.1
79 0.1
80 0.12
81 0.13
82 0.13
83 0.16
84 0.24
85 0.29
86 0.29
87 0.35
88 0.41
89 0.47
90 0.48
91 0.48
92 0.45
93 0.47
94 0.47
95 0.44
96 0.36
97 0.31
98 0.31
99 0.31
100 0.27
101 0.21
102 0.17
103 0.15
104 0.18
105 0.18
106 0.17
107 0.18
108 0.18
109 0.17
110 0.18
111 0.2
112 0.18
113 0.16
114 0.15
115 0.11
116 0.09
117 0.09
118 0.09
119 0.07
120 0.05
121 0.06
122 0.05
123 0.05
124 0.04
125 0.05
126 0.04
127 0.04
128 0.03
129 0.03
130 0.03
131 0.03
132 0.04
133 0.04
134 0.06
135 0.09
136 0.11
137 0.13
138 0.15
139 0.17
140 0.17
141 0.19
142 0.21
143 0.22
144 0.29
145 0.3
146 0.34
147 0.35
148 0.39
149 0.41
150 0.41
151 0.42
152 0.35
153 0.37
154 0.36
155 0.42
156 0.46
157 0.48
158 0.5
159 0.52
160 0.61
161 0.6
162 0.62
163 0.6
164 0.56
165 0.57
166 0.58
167 0.57
168 0.53
169 0.53
170 0.48
171 0.48
172 0.45
173 0.39
174 0.33
175 0.27
176 0.24
177 0.21
178 0.18
179 0.12
180 0.1
181 0.12
182 0.12
183 0.11
184 0.12
185 0.15
186 0.16
187 0.17
188 0.16
189 0.14
190 0.13
191 0.13
192 0.12
193 0.08
194 0.07
195 0.06
196 0.09
197 0.09
198 0.09
199 0.09
200 0.1
201 0.1
202 0.11
203 0.13
204 0.1
205 0.12
206 0.14
207 0.15
208 0.15
209 0.18
210 0.19
211 0.17
212 0.18
213 0.21
214 0.21
215 0.22
216 0.22
217 0.21
218 0.23
219 0.28
220 0.27
221 0.23
222 0.23
223 0.25
224 0.27
225 0.27
226 0.29
227 0.26
228 0.27
229 0.29
230 0.31
231 0.28
232 0.26
233 0.29
234 0.33
235 0.33
236 0.32
237 0.33
238 0.33
239 0.36
240 0.35
241 0.32
242 0.25
243 0.26
244 0.28