Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2MRI1

Protein Details
Accession A0A0D2MRI1    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
264-299RPSPSFSQLQRRRRSTPPRPIRDPTRRPRYLRELAYHydrophilic
NLS Segment(s)
PositionSequence
275-290RRRSTPPRPIRDPTRR
Subcellular Location(s) nucl 18, cyto 4, extr 3, cyto_mito 3
Family & Domain DBs
Amino Acid Sequences MAGSLSERPPPNQGAFASFDARAGSLPCSPTPPTSKNDATARVQPPRAPCLPSPLSDIPKSRHAACGSFDALVGVLLCYSAPPRPEPAAVTPAPAASTPSSCAPTTASSIRAAEPGWATHDPADPRSAPARGAASPVRATTLVQELFNATAPHGTCRTHREGGAGFFQRAHPSPLLDPSPLPRPSTSRGRRSPLPRTPRIPFAAPLDPISPPLGVAEPNGAGTVPARASMLARVPFPVSLAIPRSPNSETLPRHLRMLRCRFSRPSPSFSQLQRRRRSTPPRPIRDPTRRPRYLRELAYFTTVAPSAACETRNAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.34
3 0.35
4 0.32
5 0.27
6 0.25
7 0.22
8 0.21
9 0.18
10 0.15
11 0.14
12 0.15
13 0.17
14 0.17
15 0.21
16 0.23
17 0.28
18 0.34
19 0.36
20 0.36
21 0.42
22 0.44
23 0.46
24 0.5
25 0.5
26 0.47
27 0.52
28 0.55
29 0.54
30 0.54
31 0.51
32 0.5
33 0.51
34 0.5
35 0.46
36 0.4
37 0.41
38 0.41
39 0.39
40 0.42
41 0.41
42 0.43
43 0.43
44 0.46
45 0.41
46 0.46
47 0.47
48 0.41
49 0.41
50 0.38
51 0.36
52 0.34
53 0.35
54 0.29
55 0.26
56 0.24
57 0.17
58 0.15
59 0.13
60 0.11
61 0.06
62 0.04
63 0.04
64 0.04
65 0.04
66 0.05
67 0.07
68 0.09
69 0.1
70 0.14
71 0.17
72 0.18
73 0.2
74 0.23
75 0.27
76 0.25
77 0.26
78 0.22
79 0.2
80 0.19
81 0.17
82 0.15
83 0.1
84 0.11
85 0.11
86 0.13
87 0.15
88 0.15
89 0.15
90 0.15
91 0.15
92 0.18
93 0.18
94 0.18
95 0.16
96 0.18
97 0.18
98 0.17
99 0.15
100 0.13
101 0.12
102 0.11
103 0.14
104 0.13
105 0.13
106 0.14
107 0.17
108 0.17
109 0.17
110 0.2
111 0.15
112 0.17
113 0.19
114 0.18
115 0.15
116 0.16
117 0.17
118 0.14
119 0.17
120 0.16
121 0.16
122 0.16
123 0.16
124 0.15
125 0.13
126 0.13
127 0.11
128 0.14
129 0.13
130 0.12
131 0.12
132 0.11
133 0.12
134 0.13
135 0.11
136 0.07
137 0.08
138 0.08
139 0.1
140 0.11
141 0.11
142 0.12
143 0.17
144 0.23
145 0.23
146 0.23
147 0.23
148 0.23
149 0.24
150 0.28
151 0.24
152 0.19
153 0.18
154 0.18
155 0.18
156 0.18
157 0.18
158 0.13
159 0.13
160 0.14
161 0.17
162 0.17
163 0.16
164 0.15
165 0.15
166 0.22
167 0.22
168 0.23
169 0.2
170 0.22
171 0.27
172 0.38
173 0.43
174 0.45
175 0.5
176 0.54
177 0.6
178 0.64
179 0.69
180 0.67
181 0.69
182 0.66
183 0.66
184 0.63
185 0.62
186 0.58
187 0.5
188 0.43
189 0.39
190 0.37
191 0.32
192 0.3
193 0.25
194 0.21
195 0.21
196 0.19
197 0.14
198 0.1
199 0.1
200 0.09
201 0.08
202 0.08
203 0.08
204 0.07
205 0.08
206 0.08
207 0.07
208 0.06
209 0.06
210 0.08
211 0.06
212 0.06
213 0.07
214 0.07
215 0.08
216 0.1
217 0.15
218 0.14
219 0.15
220 0.15
221 0.16
222 0.16
223 0.16
224 0.15
225 0.11
226 0.13
227 0.16
228 0.17
229 0.18
230 0.19
231 0.23
232 0.22
233 0.24
234 0.26
235 0.31
236 0.31
237 0.36
238 0.43
239 0.4
240 0.44
241 0.46
242 0.48
243 0.5
244 0.58
245 0.59
246 0.57
247 0.62
248 0.63
249 0.66
250 0.71
251 0.66
252 0.62
253 0.6
254 0.6
255 0.6
256 0.61
257 0.64
258 0.63
259 0.68
260 0.71
261 0.71
262 0.72
263 0.76
264 0.8
265 0.8
266 0.82
267 0.83
268 0.82
269 0.84
270 0.86
271 0.87
272 0.87
273 0.87
274 0.86
275 0.86
276 0.85
277 0.83
278 0.84
279 0.82
280 0.81
281 0.78
282 0.74
283 0.69
284 0.62
285 0.62
286 0.53
287 0.43
288 0.37
289 0.29
290 0.22
291 0.16
292 0.16
293 0.15
294 0.18
295 0.18